Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVG0EXE)

DOT Name Amelogenin, Y isoform (AMELY)
Gene Name AMELY
Related Disease
Amelogenesis imperfecta type 1E ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Hepatocellular carcinoma ( )
Amelogenesis imperfecta ( )
Dentin dysplasia ( )
Dentinogenesis imperfecta ( )
UniProt ID
AMELY_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02948
Sequence
MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMI
RPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPG
QQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLR
PLPPILPDLHLEAWPATDKTKQEEVD
Function
Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Amelogenesis imperfecta type 1E DISQK3F9 Strong Biomarker [1]
Hepatitis DISXXX35 Strong Biomarker [2]
Hepatitis A virus infection DISUMFQV Strong Biomarker [2]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [2]
Amelogenesis imperfecta DISGYR9E Limited Biomarker [1]
Dentin dysplasia DISCGIX8 Limited Biomarker [1]
Dentinogenesis imperfecta DISJLZU4 Limited Biomarker [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Amelogenin, Y isoform (AMELY). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Amelogenin, Y isoform (AMELY). [4]
------------------------------------------------------------------------------------

References

1 A mutation in the mouse Amelx tri-tyrosyl domain results in impaired secretion of amelogenin and phenocopies human X-linked amelogenesis imperfecta.Hum Mol Genet. 2010 Apr 1;19(7):1230-47. doi: 10.1093/hmg/ddq001. Epub 2010 Jan 12.
2 AFP computational secreted network construction and analysis between human hepatocellular carcinoma (HCC) and no-tumor hepatitis/cirrhotic liver tissues.Tumour Biol. 2010 Oct;31(5):417-25. doi: 10.1007/s13277-010-0050-8. Epub 2010 Jun 8.
3 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.