Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVKWUDH)

DOT Name G patch domain-containing protein 11 (GPATCH11)
Synonyms Coiled-coil domain-containing protein 75
Gene Name GPATCH11
UniProt ID
GPT11_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13821 ; PF01585
Sequence
MRSARSTALNRGEQRAVRYYSHMKLNMAEEEDYMSDSFINVQEDIRPGLPMLRQIREARR
KEEKQQEANLKNRQKSLKEEEQERRDIGLKNALGCENKGFALLQKMGYKSGQALGKSGGG
IVEPIPLNIKTGKSGIGHEASLKRKAEEKLESYRKKIHMKNQAEEKAAEQFRMRLKNKQD
EMKLEGDLRRSQRACQQLDVQKNIQVPREAWYWLRLEEETEEDEEEKEQDEDEYKSEDLS
VLEKLQILTSYLREEHLYCIWCGTAYEDKEDLSSNCPGPTSADHD

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of G patch domain-containing protein 11 (GPATCH11). [1]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of G patch domain-containing protein 11 (GPATCH11). [2]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of G patch domain-containing protein 11 (GPATCH11). [3]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate decreases the expression of G patch domain-containing protein 11 (GPATCH11). [4]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of G patch domain-containing protein 11 (GPATCH11). [5]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of G patch domain-containing protein 11 (GPATCH11). [6]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of G patch domain-containing protein 11 (GPATCH11). [7]
Resorcinol DMM37C0 Investigative Resorcinol decreases the expression of G patch domain-containing protein 11 (GPATCH11). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
2 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
3 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
4 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
7 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
8 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.