Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVMFNOK)

• DOT Name: F-box only protein 48 (FBXO48)
• Synonyms: F-box protein 48
• Gene Name: FBXO48
• Related Disease: Parkinson disease
• UniProt ID: FBX48_HUMAN
• Pfam ID: PF12937
• Sequence:
  MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASL
  TCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLS
  GRYSNICSPISLPEKIMYPMDADTWGEILEAELER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Limited	Genetic Variation	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of F-box only protein 48 (FBXO48).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of F-box only protein 48 (FBXO48).	[3]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of F-box only protein 48 (FBXO48).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of F-box only protein 48 (FBXO48).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of F-box only protein 48 (FBXO48).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of F-box only protein 48 (FBXO48).	[7]

References

• [1] Genetic analysis of the FBXO48 gene in Chinese Han patients with Parkinson disease.Neurosci Lett. 2013 Apr 29;541:224-6. doi: 10.1016/j.neulet.2013.02.031. Epub 2013 Feb 26.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [7] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.