Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW0PCKU)

DOT Name	Interferon alpha-8 (IFNA8)
Synonyms	IFN-alpha-8; Interferon alpha-B; LeIF B; Interferon alpha-B2
Gene Name	IFNA8
Related Disease	Anemia ( ) Lung cancer ( ) Lung carcinoma ( ) Neoplasm ( ) Squamous cell carcinoma ( )
UniProt ID	IFNA8_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	6JHD
Pfam ID	PF00143
Sequence	MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFE FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLE SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSIN LQKRLKSKE
Function	Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) PI3K-Akt sig.ling pathway (hsa04151 ) Necroptosis (hsa04217 ) Toll-like receptor sig.ling pathway (hsa04620 ) NOD-like receptor sig.ling pathway (hsa04621 ) RIG-I-like receptor sig.ling pathway (hsa04622 ) Cytosolic D.-sensing pathway (hsa04623 ) JAK-STAT sig.ling pathway (hsa04630 ) .tural killer cell mediated cytotoxicity (hsa04650 ) Alcoholic liver disease (hsa04936 ) Tuberculosis (hsa05152 ) Hepatitis C (hsa05160 ) Hepatitis B (hsa05161 ) Measles (hsa05162 ) Human cytomegalovirus infection (hsa05163 ) Influenza A (hsa05164 ) Human papillomavirus infection (hsa05165 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Herpes simplex virus 1 infection (hsa05168 ) Epstein-Barr virus infection (hsa05169 ) Human immunodeficiency virus 1 infection (hsa05170 ) Coro.virus disease - COVID-19 (hsa05171 ) Pathways in cancer (hsa05200 ) Autoimmune thyroid disease (hsa05320 ) Lipid and atherosclerosis (hsa05417 )
Reactome Pathway	Regulation of IFNA/IFNB signaling (R-HSA-912694 ) TRAF6 mediated IRF7 activation (R-HSA-933541 ) SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 ) Factors involved in megakaryocyte development and platelet production (R-HSA-983231 ) Interferon alpha/beta signaling (R-HSA-909733 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Anemia	DISTVL0C	Strong	Genetic Variation	[1]
Lung cancer	DISCM4YA	Strong	Biomarker	[2]
Lung carcinoma	DISTR26C	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Interferon alpha-8 (IFNA8).	[4]
------------------------------------------------------------------------------------

References

1	Reduced interferon (IFN)- conditioned by IFNA2 (-173) and IFNA8 (-884) haplotypes is associated with enhanced susceptibility to severe malarial anemia and longitudinal all-cause mortality.Hum Genet. 2012 Aug;131(8):1375-91. doi: 10.1007/s00439-012-1175-1. Epub 2012 May 9.
2	Serous IFNA3 predicts unfavorable prognosis in lung cancer via abnormal activation of AKT signaling.IUBMB Life. 2019 Nov;71(11):1806-1814. doi: 10.1002/iub.2152. Epub 2019 Aug 16.
3	Genome-wide association study of familial lung cancer.Carcinogenesis. 2018 Sep 21;39(9):1135-1140. doi: 10.1093/carcin/bgy080.
4	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.