Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW49WA4)

• DOT Name: Coiled-coil domain-containing protein 81 (CCDC81)
• Gene Name: CCDC81
• Related Disease: Eosinophilic esophagitis
• UniProt ID: CCD81_HUMAN
• Pfam ID: PF14908 ; PF18289
• Sequence:
  MLDTIARALQDLGRQVLPTLPSLSQEEVSIIWGNVSEFVRRQLTLHKGVQIPAFGTFTFI
  RQKLEVGNNKFILIQRPVFIMVEKLVQIHGLKQNKVYTPGEIPIVPLNFVMISLEGPFNR
  DVVEGCVKETLLFLSRSISMKQNVEFTFKGIGVLMIRDSKVKMRFYKDFLCTMDGSGALA
  KALANRPGTVDSVLSSREALRKWPSSVLAFPRIELKEMENKLPMETLVEECGENRERKCK
  LKDQSDKEEGTRDISSPKRLRDRQALFPAKVTNVSLLEKFERSESGGKIMTPESLSYPSC
  LKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEERRREIEDERLIQQYQM
  LKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEKPEFYKSFLFDKRPLSPAL
  NALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEET
  QCYKRALDAQIKNKPSRLPPFEPDSSEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHK
  RKAILHQLVDQRRDLQMLQRTQREHLADRTAELERVNRVNQCLQEDWERSAAMKKQRDLE
  DKAFERASDKLFLLDQCEKYRRCKQCQRRTSNVGESNLWPLNKFLPGSRLLV

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Eosinophilic esophagitis	DISR8WSB	Strong	Genetic Variation	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Coiled-coil domain-containing protein 81 (CCDC81).	[2]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Coiled-coil domain-containing protein 81 (CCDC81).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Coiled-coil domain-containing protein 81 (CCDC81).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Coiled-coil domain-containing protein 81 (CCDC81).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coiled-coil domain-containing protein 81 (CCDC81).	[4]

References

• [1] Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.Nat Genet. 2014 Aug;46(8):895-900. doi: 10.1038/ng.3033. Epub 2014 Jul 13.
• [2] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [3] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.