Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW4GF3X)

DOT Name	Syntaxin-18 (STX18)
Synonyms	Cell growth-inhibiting gene 9 protein
Gene Name	STX18
Related Disease	Acute liver failure ( ) Atrial septal defect ( ) Autism spectrum disorder ( ) Breast cancer ( ) Breast carcinoma ( ) Congenital heart disease ( )
UniProt ID	STX18_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF10496
Sequence	MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHI GKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHK EIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES TSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE DIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS
Function	Syntaxin that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
Tissue Specificity	Ubiquitous.
KEGG Pathway	S.RE interactions in vesicular transport (hsa04130 ) Phagosome (hsa04145 )
Reactome Pathway	COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Acute liver failure	DIS5EZKX	Strong	Biomarker	[1]
Atrial septal defect	DISJT76B	Strong	Biomarker	[2]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Congenital heart disease	DISQBA23	Limited	Genetic Variation	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Syntaxin-18 (STX18).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Syntaxin-18 (STX18).	[7]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Syntaxin-18 (STX18).	[8]
------------------------------------------------------------------------------------

References

1	Recurrent acute liver failure due to NBAS deficiency: phenotypic spectrum, disease mechanisms, and therapeutic concepts.J Inherit Metab Dis. 2016 Jan;39(1):3-16. doi: 10.1007/s10545-015-9896-7. Epub 2015 Nov 5.
2	Association between the 4p16 genomic locus and different types of congenital heart disease: results from adult survivors in the UK Biobank.Sci Rep. 2019 Nov 11;9(1):16515. doi: 10.1038/s41598-019-52969-x.
3	Genome-wide association study of multiple congenital heart disease phenotypes identifies a susceptibility locus for atrial septal defect at chromosome 4p16.Nat Genet. 2013 Jul;45(7):822-4. doi: 10.1038/ng.2637. Epub 2013 May 26.
4	Effective stimulation of growth in MCF-7 human breast cancer cells by inhibition of syntaxin18 by external guide sequence and ribonuclease P.Cancer Lett. 2008 Dec 8;272(1):167-75. doi: 10.1016/j.canlet.2008.07.014. Epub 2008 Aug 22.
5	Characterization of soluble N-ethylmaleimide-sensitive factor attachment protein receptor gene STX18 variations for possible roles in congenital heart diseases.Gene. 2017 Jan 20;598:79-83. doi: 10.1016/j.gene.2016.10.043. Epub 2016 Nov 2.
6	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
7	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.