General Information of Drug Off-Target (DOT) (ID: OTW64NPU)

DOT Name Elongation factor 1-beta (EEF1B2)
Synonyms EF-1-beta
Gene Name EEF1B2
Related Disease
Visceral leishmaniasis ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Hepatocellular carcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
Intellectual disability ( )
Neurodevelopmental disorder ( )
UniProt ID
EF1B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1B64; 5DQS
Pfam ID
PF10587 ; PF00736
Sequence
MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIK
SYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLRE
ERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Function EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.
Reactome Pathway
Eukaryotic Translation Elongation (R-HSA-156842 )

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Visceral leishmaniasis DISTKEYK Definitive Biomarker [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Breast neoplasm DISNGJLM Strong Biomarker [2]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [3]
Lung cancer DISCM4YA Strong Biomarker [4]
Lung carcinoma DISTR26C Strong Biomarker [4]
Neoplasm DISZKGEW Strong Biomarker [5]
Intellectual disability DISMBNXP moderate Genetic Variation [6]
Neurodevelopmental disorder DIS372XH Limited Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Elongation factor 1-beta (EEF1B2). [8]
Estradiol DMUNTE3 Approved Estradiol decreases the phosphorylation of Elongation factor 1-beta (EEF1B2). [11]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Elongation factor 1-beta (EEF1B2). [13]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Elongation factor 1-beta (EEF1B2). [15]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Elongation factor 1-beta (EEF1B2). [16]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Elongation factor 1-beta (EEF1B2). [9]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Elongation factor 1-beta (EEF1B2). [10]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Elongation factor 1-beta (EEF1B2). [12]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Elongation factor 1-beta (EEF1B2). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Elongation factor 1-beta (EEF1B2). [17]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Elongation factor 1-beta (EEF1B2). [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Recombinant Leishmania eukaryotic elongation factor-1 beta protein: A potential diagnostic antigen to detect tegumentary and visceral leishmaniasis in dogs and humans.Microb Pathog. 2019 Dec;137:103783. doi: 10.1016/j.micpath.2019.103783. Epub 2019 Oct 7.
2 Glycolytic cancer associated fibroblasts promote breast cancer tumor growth, without a measurable increase in angiogenesis: evidence for stromal-epithelial metabolic coupling.Cell Cycle. 2010 Jun 15;9(12):2412-22. doi: 10.4161/cc.9.12.11989. Epub 2010 Jun 15.
3 Alterations in Eukaryotic Elongation Factor complex proteins (EEF1s) in cancer and their implications in epigenetic regulation.Life Sci. 2019 Dec 1;238:116977. doi: 10.1016/j.lfs.2019.116977. Epub 2019 Oct 19.
4 The expression profile and prognostic significance of eukaryotic translation elongation factors in different cancers.PLoS One. 2018 Jan 17;13(1):e0191377. doi: 10.1371/journal.pone.0191377. eCollection 2018.
5 Independent overexpression of the subunits of translation elongation factor complex eEF1H in human lung cancer.BMC Cancer. 2014 Dec 3;14:913. doi: 10.1186/1471-2407-14-913.
6 New evidence that biallelic loss of function in EEF1B2 gene leads to intellectual disability.Clin Genet. 2020 Apr;97(4):639-643. doi: 10.1111/cge.13688. Epub 2020 Jan 7.
7 The role of translation elongation factor eEF1 subunits in neurodevelopmental disorders.Hum Mutat. 2019 Feb;40(2):131-141. doi: 10.1002/humu.23677. Epub 2018 Nov 23.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 Expression Profiling of Human Pluripotent Stem Cell-Derived Cardiomyocytes Exposed to Doxorubicin-Integration and Visualization of Multi-Omics Data. Toxicol Sci. 2018 May 1;163(1):182-195. doi: 10.1093/toxsci/kfy012.
10 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
11 The G Protein-Coupled Estrogen Receptor Agonist G-1 Inhibits Nuclear Estrogen Receptor Activity and Stimulates Novel Phosphoproteomic Signatures. Toxicol Sci. 2016 Jun;151(2):434-46. doi: 10.1093/toxsci/kfw057. Epub 2016 Mar 29.
12 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
13 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
14 Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
15 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
16 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
17 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
18 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.