Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW96SNS)

• DOT Name: Paraneoplastic antigen-like protein 6A (PNMA6A)
• Gene Name: PNMA6A
• UniProt ID: PNM6A_HUMAN
• Pfam ID: PF14893 ; PF20846
• Sequence:
  MAVTMLQDWCRWMGVNARRGLLILGIPEDCDDAEFQESLEAALRPMGHFTVLGKAFREED
  NATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVE
  SVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVFSGRDQPAPGEESFEVWLDHTTE
  MLHVWQGVSERERRRRLLEGLRGTALQLVHALLAENPARTAQDCLAALAQVFGDNESQAT
  IRVKCLTAQQQSGERLSAFVLRLEVLLQKAMEKEALARASADRVRLRQMLTRAHLTEPLD
  EALRKLRMAGRSPSFLEMLGLVRESEAWEASLARSVRAQTQEGAGARAGAQAVARASTKV
  EAVPGGPGREPEGLLQAGGQEAEELLQEGLKPVLEECDN
• Tissue Specificity: Expressed in the brain.

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Paraneoplastic antigen-like protein 6A (PNMA6A).	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[4]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[7]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Paraneoplastic antigen-like protein 6A (PNMA6A).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [8] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [9] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.