Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWIRR5U)

• DOT Name: Beta-1,3-galactosyltransferase 1 (B3GALT1)
• Synonyms: Beta-1,3-GalTase 1; Beta3Gal-T1; Beta3GalT1; EC 2.4.1.86; UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1
• Gene Name: B3GALT1
• Related Disease:
  Adenocarcinoma
  Peters plus syndrome
• UniProt ID: B3GT1_HUMAN
• EC Number: 2.4.1.86
• Pfam ID: PF01762
• Sequence:
  MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
  HSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
  NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
  FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
  YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
  ITVHQISPEEMHRIWNDMSSKKHLRC
• Function: Beta-1,3-galactosyltransferase that transfers galactose from UDP-alpha-D-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins. Inactive towards substrates with terminal alpha-N-acetylglucosamine (alpha-GlcNAc) or alpha-N-acetylgalactosamine (alpha-GalNAc) residues.
• Tissue Specificity: Detected in brain and colon mucosa and to a lesser extent in colon adenocarcinoma cells.
• KEGG Pathway:
  Glycosphingolipid biosynthesis - lacto and neolacto series (hsa00601)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Lewis blood group biosynthesis (R-HSA-9037629)
• BioCyc Pathway: MetaCyc:ENSG00000172318-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[1]
Peters plus syndrome	DISIUM7O	Strong	Biomarker	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Beta-1,3-galactosyltransferase 1 (B3GALT1).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Beta-1,3-galactosyltransferase 1 (B3GALT1).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Beta-1,3-galactosyltransferase 1 (B3GALT1).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Beta-1,3-galactosyltransferase 1 (B3GALT1).	[5]

References

• [1] Differential expression of beta1,3galactosyltransferases in human colon cells derived from adenocarcinomas or normal mucosa.FEBS Lett. 1999 May 14;451(1):75-80. doi: 10.1016/s0014-5793(99)00547-5.
• [2] Peters Plus syndrome is caused by mutations in B3GALTL, a putative glycosyltransferase. Am J Hum Genet. 2006 Sep;79(3):562-6. doi: 10.1086/507567. Epub 2006 Jul 19.
• [3] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.