Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWS7OY4)

• DOT Name: TP53-target gene 3 protein (TP53TG3)
• Synonyms: TP53-inducible gene 3 protein
• Gene Name: TP53TG3
• Related Disease: Advanced cancer
• UniProt ID: T53G3_HUMAN
• Sequence:
  MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPC
  CFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLS
  SFSG
• Function: May play a significant role in p53/TP53-mediating signaling pathway.
• Tissue Specificity: Strongly expressed in testis. Weakly expressed in heart, placenta and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of TP53-target gene 3 protein (TP53TG3).	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of TP53-target gene 3 protein (TP53TG3).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of TP53-target gene 3 protein (TP53TG3).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of TP53-target gene 3 protein (TP53TG3).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of TP53-target gene 3 protein (TP53TG3).	[5]

References

• [1] Isolation and characterization of a novel TP53-inducible gene, TP53TG3.Genes Chromosomes Cancer. 1999 Dec;26(4):329-35.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [4] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [5] Global gene expression analysis reveals novel transcription factors associated with long-term low-level exposure of EA.hy926 human endothelial cells to bisphenol A. Chem Biol Interact. 2023 Aug 25;381:110571. doi: 10.1016/j.cbi.2023.110571. Epub 2023 May 25.