Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWTE24S)

• DOT Name: Transcriptional repressor scratch 1 (SCRT1)
• Synonyms: Scratch homolog 1 zinc finger protein; SCRT; Scratch 1; hScrt
• Gene Name: SCRT1
• Related Disease:
  Advanced cancer
  Carcinoma
  Lung cancer
  Melanoma
  Neoplasm
• UniProt ID: SCRT1_HUMAN
• Pfam ID: PF00096 ; PF13912
• Sequence:
  MPRSFLVKKVKLDAFSSADLESAYGRARSDLGAPLHDKGYLSDYVGPSSVYDGDAEAALL
  KGPSPEPMYAAAVRGELGPAAAGSAPPPTPRPELATAAGGYINGDAAVSEGYAADAFFIT
  DGRSRRKASNAGAAAAPSTASAAAPDGDAGGGGGAGGRSLGSGPGGRGGTRAGAGTEARA
  GPGAAGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMH
  LLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSA
  FKHFQCKRCKKSFALKSYLNKHYESACFKGGAGGPAAPAPPQLSPVQA
• Function: Transcriptional repressor that binds E-box motif CAGGTG. Can modulate the action of basic helix-loop-helix (bHLH) transcription factors, critical for neuronal differentiation.
• Tissue Specificity: Brain specific.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Carcinoma	DISH9F1N	Strong	Altered Expression	[1]
Lung cancer	DISCM4YA	Strong	Altered Expression	[1]
Melanoma	DIS1RRCY	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transcriptional repressor scratch 1 (SCRT1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcriptional repressor scratch 1 (SCRT1).	[4]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Transcriptional repressor scratch 1 (SCRT1).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transcriptional repressor scratch 1 (SCRT1).	[5]

References

• [1] The SNAIL family member SCRATCH1 is not expressed in human tumors.Oncol Rep. 2010 Feb;23(2):523-9.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.