Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXFDNZN)

• DOT Name: Required for drug-induced death protein 1 (C1ORF115)
• Gene Name: C1ORF115
• UniProt ID: RDD1_HUMAN
• Pfam ID: PF15828
• Sequence:
  MTVGARLRSKAESSLLRRGPRGRGRTEGDEEAAAILEHLEYADEAEAAAESGTSAADERG
  PGTRGARRVHFALLPERYEPLEEPAPSEQPRKRYRRKLKKYGKNVGKVIIKGCRYVVIGL
  QGFAAAYSAPFAVATSVVSFVR
• Function: Regulates drug efflux through modulation of ABCB1 localization and activity.

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Required for drug-induced death protein 1 (C1ORF115).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[6]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[7]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[10]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[11]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Required for drug-induced death protein 1 (C1ORF115).	[12]

References

• [1] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [8] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [9] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [10] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [11] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [12] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.