Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXGZ8FV)

DOT Name	Securin-2 (PTTG2)
Synonyms	Pituitary tumor-transforming gene 2 protein
Gene Name	PTTG2
Related Disease	Esophageal squamous cell carcinoma ( ) Non-small-cell lung cancer ( ) Psoriasis ( )
UniProt ID	PTTG2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF04856
Sequence	MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKAT RKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPF NLLDFESFDLPEERQIAHLPLSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLLQ SPSSILSTLDVELPAVCYDIDI
Tissue Specificity	Expressed at low levels in the pituitary, liver, spleen, prostate, testis, ovary, small intestine and colon. Also expressed in various pituitary, testicular, liver and ovarian tumors.
KEGG Pathway	Cell cycle (hsa04110 ) Oocyte meiosis (hsa04114 ) Human T-cell leukemia virus 1 infection (hsa05166 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[1]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[2]
Psoriasis	DIS59VMN	Strong	Biomarker	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Securin-2 (PTTG2).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Securin-2 (PTTG2).	[6]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Securin-2 (PTTG2).	[6]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Securin-2 (PTTG2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Securin-2 (PTTG2).	[7]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Securin-2 (PTTG2).	[8]
------------------------------------------------------------------------------------

References

1	The Pseudogene PTTG3P Promotes Cell Migration and Invasion in Esophageal Squamous Cell Carcinoma.Open Med (Wars). 2019 Jun 30;14:516-522. doi: 10.1515/med-2019-0057. eCollection 2019.
2	Distinct expression pattern and prognostic values of pituitary tumor transforming gene family genes in non-small cell lung cancer.Oncol Lett. 2019 Nov;18(5):4481-4494. doi: 10.3892/ol.2019.10844. Epub 2019 Sep 10.
3	Pituitary tumor transforming gene PTTG2 induces psoriasis by regulating vimentin and E-cadherin expression.Int J Clin Exp Pathol. 2015 Sep 1;8(9):10887-93. eCollection 2015.
4	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
6	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.