Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXHYFOD)

• DOT Name: Potassium channel regulatory protein (KCNRG)
• Synonyms: Potassium channel regulator; Protein CLLD4
• Gene Name: KCNRG
• Related Disease:
  Adult lymphoma
  Chromosomal disorder
  Hepatocellular carcinoma
  Lymphoma
  Pediatric lymphoma
  Plasma cell myeloma
  Pneumonitis
  Prostate neoplasm
  Gastrointestinal stromal tumour
  Neoplasm
  Small lymphocytic lymphoma
• UniProt ID: KCNRG_HUMAN
• Pfam ID: PF02214
• Sequence:
  MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSF
  ILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQ
  AFFRVFGSCSKTIEMLTGRITVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQC
  GSDSTTDNQTGVRYVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTRTVSSEDKTECY
  SFERIKSPEVLITNETPKPETIIIPEQSQIKK
• Function: Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes.
• Tissue Specificity: Ubiquitous in normal tissues and expressed in some tumor tissues.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult lymphoma	DISK8IZR	Strong	Altered Expression	[1]
Chromosomal disorder	DISM5BB5	Strong	Genetic Variation	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[2]
Lymphoma	DISN6V4S	Strong	Altered Expression	[1]
Pediatric lymphoma	DIS51BK2	Strong	Altered Expression	[1]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[1]
Pneumonitis	DIS88E0K	Strong	Genetic Variation	[3]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[4]
Gastrointestinal stromal tumour	DIS6TJYS	moderate	Biomarker	[5]
Neoplasm	DISZKGEW	Limited	Altered Expression	[1]
Small lymphocytic lymphoma	DIS30POX	Limited	Biomarker	[1]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Potassium channel regulatory protein (KCNRG).	[6]

References

• [1] Pro-apoptotic and antiproliferative activity of human KCNRG, a putative tumor suppressor in 13q14 region.Tumour Biol. 2010 Jan;31(1):33-45. doi: 10.1007/s13277-009-0005-0. Epub 2009 Dec 18.
• [2] Genetic and expression analysis of the KCNRG gene in hepatocellular carcinomas.Exp Mol Med. 2006 Jun 30;38(3):247-55. doi: 10.1038/emm.2006.30.
• [3] Lymphocyte-driven regional immunopathology in pneumonitis caused by impaired central immune tolerance.Sci Transl Med. 2019 Jun 5;11(495):eaav5597. doi: 10.1126/scitranslmed.aav5597.
• [4] A new human gene KCNRG encoding potassium channel regulating protein is a cancer suppressor gene candidate located in 13q14.3.FEBS Lett. 2003 Mar 27;539(1-3):156-60. doi: 10.1016/s0014-5793(03)00211-4.
• [5] Aberrations of chromosome 13q in gastrointestinal stromal tumors: analysis of 91 cases by fluorescence in situ hybridization (FISH).Diagn Mol Pathol. 2009 Jun;18(2):72-80. doi: 10.1097/PDM.0b013e318181fa1f.
• [6] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.