Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXOW6XJ)

DOT Name	Alpha-S1-casein (CSN1S1)
Gene Name	CSN1S1
Related Disease	Serum sickness ( ) Breast cancer ( ) Breast carcinoma ( ) Neoplasm ( ) Penile cancer ( ) Sleep disorder ( ) Thrombocytopenia ( )
UniProt ID	CASA1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQ TDEIKDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQ EQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNN VMLQW
Function	Important role in the capacity of milk to transport calcium phosphate.; Casoxin D acts as opioid antagonist and has vasorelaxing activity mediated by bradykinin B1 receptors.
Tissue Specificity	Mammary gland specific. Secreted in milk.
Reactome Pathway	Miscellaneous transport and binding events (R-HSA-5223345 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Serum sickness	DIS0MRKJ	Definitive	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[3]
Penile cancer	DISGVGNQ	Strong	Genetic Variation	[3]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[4]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Alpha-S1-casein (CSN1S1).	[6]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Alpha-S1-casein (CSN1S1).	[7]
------------------------------------------------------------------------------------

References

1	Autoantibodies to S1-casein are induced by breast-feeding.PLoS One. 2012;7(4):e32716. doi: 10.1371/journal.pone.0032716. Epub 2012 Apr 4.
2	Adjuvant pegylated liposomal doxorubicin for older women with endocrine nonresponsive breast cancer who are NOT suitable for a "standard chemotherapy regimen": the CASA randomized trial.Breast. 2013 Apr;22(2):130-137. doi: 10.1016/j.breast.2013.01.015. Epub 2013 Feb 28.
3	CSN1 Somatic Mutations in Penile Squamous Cell Carcinoma.Cancer Res. 2016 Aug 15;76(16):4720-4727. doi: 10.1158/0008-5472.CAN-15-3134. Epub 2016 Jun 20.
4	A Double-Blind, Randomized, Placebo-Controlled Crossover Clinical Study of the Effects of Alpha-s1 Casein Hydrolysate on Sleep Disturbance.Nutrients. 2019 Jun 27;11(7):1466. doi: 10.3390/nu11071466.
5	Shigatoxin triggers thrombotic thrombocytopenic purpura in genetically susceptible ADAMTS13-deficient mice.J Clin Invest. 2005 Oct;115(10):2752-61. doi: 10.1172/JCI26007.
6	The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.