Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXTYWXJ)

DOT Name Transmembrane protein 102 (TMEM102)
Synonyms Common beta-chain associated protein; CBAP
Gene Name TMEM102
Related Disease
Metabolic disorder ( )
T-cell acute lymphoblastic leukaemia ( )
UniProt ID
TM102_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASAVWGSAPWWGPPPPAPARPLTDIDFCSGAQLQELTQLIQELGVQESWSDGPKPGADL
LRAKDFVFSLLGLVHRRDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYARGPHYDAGFT
LLVPMFSLDGTELQLDLESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARDSIHRTESE
ESSKDWQSSVDQPHSYVTEHEAPVSLEKSPSDVSASESPQHDVVDLGSTAPLKTMSSDVT
KAAVESPVPKPSEAREAWPTLCSAQVAAWFFATLAAVAESLIPVPGAPRLVHAARHAGFT
TVLLATPEPPRRLLLFDLIPVVSVAGWPEGARSHSWAGPLASESASFYLVPGGGTERPCA
SAWQLCFARQELALKARIPAPLLQAHAAAQALLRPLVAGTRAAAPYLLRTLLYWACERLP
ALYLARPENAGACCLGLLDELGRVLEAGTLPHYFLNGRQLRTGDDSAALLGELARLRGDP
ARALRAAVEEAKVARKGGGLAGVGGGAH
Function Selectively involved in CSF2 deprivation-induced apoptosis via a mitochondria-dependent pathway.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Metabolic disorder DIS71G5H Strong Biomarker [1]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Transmembrane protein 102 (TMEM102). [2]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Transmembrane protein 102 (TMEM102). [3]
Testosterone DM7HUNW Approved Testosterone increases the expression of Transmembrane protein 102 (TMEM102). [3]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Transmembrane protein 102 (TMEM102). [4]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Transmembrane protein 102 (TMEM102). [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Transmembrane protein 102 (TMEM102). [6]
------------------------------------------------------------------------------------

References

1 CBAP modulates Akt-dependent TSC2 phosphorylation to promote Rheb-mTORC1 signaling and growth of T-cell acute lymphoblastic leukemia.Oncogene. 2019 Feb;38(9):1432-1447. doi: 10.1038/s41388-018-0507-6. Epub 2018 Sep 28.
2 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
3 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
4 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
5 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
6 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.