Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXX1OWL)

DOT Name	Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14)
Synonyms	UDPG pyrophosphatase; UGPPase; EC 3.6.1.45; Nucleoside diphosphate-linked moiety X motif 14; Nudix motif 14
Gene Name	NUDT14
UniProt ID	NUD14_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3Q91
EC Number	3.6.1.45
Sequence	MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQ FRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVAC KEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIE VVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNLDLQ
Function	Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose.
Reactome Pathway	Synthesis of dolichyl-phosphate-glucose (R-HSA-480985 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14).	[1]
------------------------------------------------------------------------------------

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14).	[2]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Uridine diphosphate glucose pyrophosphatase NUDT14 (NUDT14).	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
3	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
4	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6	Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.