Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY6D30G)

• DOT Name: Protein canopy homolog 1 (CNPY1)
• Gene Name: CNPY1
• UniProt ID: CNPY1_HUMAN
• Pfam ID: PF11938
• Sequence:
  MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEI
  SSLIAQETHYLADKLCSEKSDLCETSANHTEL

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein canopy homolog 1 (CNPY1).	[1]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein canopy homolog 1 (CNPY1).	[2]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein canopy homolog 1 (CNPY1).	[5]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein canopy homolog 1 (CNPY1).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Protein canopy homolog 1 (CNPY1).	[4]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [5] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.