Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYUXICC)

DOT Name	POM121-like protein 12 (POM121L12)
Gene Name	POM121L12
Related Disease	Tourette syndrome ( )
UniProt ID	P1L12_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15229
Sequence	MGAAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQ SHIQYFQWGRPVPSTHLIEVRPTQDPAKPQRVVSEGWRRPALPGETALGRDLSCAWEGCM KGGLCRAWNPGRTWSPVTIGIAPPERQESPWRSPGQRARPAGRPAAQELLDPCTRETLLG ALSQCPKGSARFDGPLWFEVSDSKGGRRNLQPRPSAFKPLSKNGAVASFVPRPGPLKPSL GPWSLSFCDDAWPSVLVQPAPSAIWDFWEATTPSCGSCSRVSFALEVTQSAGPFGS

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Tourette syndrome	DISX9D54	No Known	Unknown	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of POM121-like protein 12 (POM121L12).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of POM121-like protein 12 (POM121L12).	[3]
------------------------------------------------------------------------------------

References

1	Benzodiazepine interactions with GABAA receptors on chick ciliary ganglion neurons. Mol Pharmacol. 1988 Aug;34(2):129-35.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.