Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ6KH9M)

• DOT Name: Hydroxysteroid 11-beta-dehydrogenase 1-like protein (HSD11B1L)
• Synonyms: EC 1.1.1.-; 11-beta-hydroxysteroid dehydrogenase type 3; 11-DH3; 11-beta-HSD3; Short chain dehydrogenase/reductase family 26C member 2; Short-chain dehydrogenase/reductase 10
• Gene Name: HSD11B1L
• Related Disease:
  Lung cancer
  Lung carcinoma
  Epithelial ovarian cancer
• UniProt ID: DHI1L_HUMAN
• EC Number: 1.1.1.-
• Pfam ID: PF00106
• Sequence:
  MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTA
  HTEALLQKVVGNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAP
  AGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSA
  AKFALDGFFGSLRRELDVQDVNVAITMCVLGLRDRASAAEAVRSSTSRPRQPEHRGVPLQ
  SQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVPRVR
  RLCRGLARPHLFGHD
• KEGG Pathway:
  Steroid hormone biosynthesis (hsa00140)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Metabolic pathways (hsa01100)
  Chemical carcinogenesis - D. adducts (hsa05204)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Strong	Altered Expression	[1]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[1]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Hydroxysteroid 11-beta-dehydrogenase 1-like protein (HSD11B1L).	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Hydroxysteroid 11-beta-dehydrogenase 1-like protein (HSD11B1L).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Hydroxysteroid 11-beta-dehydrogenase 1-like protein (HSD11B1L).	[5]

References

• [1] Isolation and characterization of novel human short-chain dehydrogenase/reductase SCDR10B which is highly expressed in the brain and acts as hydroxysteroid dehydrogenase.Acta Biochim Pol. 2009;56(2):279-89. Epub 2009 May 12.
• [2] Steroid-converting enzymes in human ovarian carcinomas.Mol Cell Endocrinol. 2009 Mar 25;301(1-2):51-8. doi: 10.1016/j.mce.2008.07.015. Epub 2008 Aug 3.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.