Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZJW4TH)

• DOT Name: Choriogonadotropin subunit beta variant 2 (CGB2)
• Gene Name: CGB2
• Related Disease:
  Hydatidiform mole
  Ovarian cancer
  Advanced cancer
  Epithelial ovarian cancer
  Ovarian neoplasm
• UniProt ID: CGB2_HUMAN
• Pfam ID: PF00007
• Sequence:
  MSKGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMT
  RVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGG
  PKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Tissue Specificity: Expressed in placenta, testis and pituitary.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hydatidiform mole	DISKNP7O	Strong	Altered Expression	[1]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[3]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[4]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Choriogonadotropin subunit beta variant 2 (CGB2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Choriogonadotropin subunit beta variant 2 (CGB2).	[7]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Choriogonadotropin subunit beta variant 2 (CGB2).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Choriogonadotropin subunit beta variant 2 (CGB2).	[8]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Choriogonadotropin subunit beta variant 2 (CGB2).	[9]
norfluoxetine	DMKNUP3	Investigative	norfluoxetine increases the expression of Choriogonadotropin subunit beta variant 2 (CGB2).	[9]

References

• [1] Fine-scale quantification of HCG beta gene transcription in human trophoblastic and non-malignant non-trophoblastic tissues.Mol Hum Reprod. 2008 Jan;14(1):23-31. doi: 10.1093/molehr/gam082. Epub 2007 Nov 29.
• [2] Regulation of human chorionic gonadotropin beta subunit expression in ovarian cancer.BMC Cancer. 2019 Jul 30;19(1):746. doi: 10.1186/s12885-019-5960-2.
• [3] Novel insights into the expression of CGB1 & 2 genes by epithelial cancer cell lines secreting ectopic free hCG.Anticancer Res. 2014 May;34(5):2239-48.
• [4] Human chorionic gonadotropin beta subunit genes CGB1 and CGB2 are transcriptionally active in ovarian cancer.Int J Mol Sci. 2013 Jun 17;14(6):12650-60. doi: 10.3390/ijms140612650.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [9] Effects of selective serotonin-reuptake inhibitors (SSRIs) on human villous trophoblasts syncytialization. Toxicol Appl Pharmacol. 2018 Jun 15;349:8-20. doi: 10.1016/j.taap.2018.04.018. Epub 2018 Apr 19.