Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTZRD883)
DOT Name | Taste receptor type 2 member 60 (TAS2R60) | ||||
---|---|---|---|---|---|
Synonyms | T2R60; Taste receptor type 2 member 56; T2R56 | ||||
Gene Name | TAS2R60 | ||||
Related Disease | |||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLV
SLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCV KIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNV TGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQ AHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN CRLRAVLKSRRSSRCGTP |
||||
Function |
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
|
||||
Tissue Specificity | Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
References