Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZUC9LR)

• DOT Name: Putative tyrosine carboxypeptidase MATCAP2 (MATCAP2)
• Synonyms: EC 3.4.17.-
• Gene Name: MATCAP2
• UniProt ID: MACA2_HUMAN
• EC Number: 3.4.17.-
• Pfam ID: PF08014
• Sequence:
  MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTSE
  KLHWPEQELAKKSILNAEDSLIIDNKRSISHLSSGVLKDIFTTGTSSYNVLLQSKEEKKY
  HSQKQSSSTYSKRCRKPSKSPNTSRSKDPRRMKALVPVTSSGTWYCLERRPAVFVTSSVS
  SPVKFTHDISVTGNGIVLPPKPKSKVKWCHFSTLPKPKPQLSRSFEKGDDFSGKKFCILT
  AIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHSHASDRFLKQIVVHLTEDLLS
  RASMTVVNGCPTLTINVSTAREHWLEGMLRHEIGTHYFRGINNLQQPWNSWTGRKKHELK
  PNNPTEEGLASIHSVLFRKDPFLWRAALLYYTVYQASQMSFCELFKDIGRFVKDPNTRWD
  YCVRAKRGWTDTSQPGCFSKDQVYLDGILQILRYRDTIDFHLLTALGKVSYEDVDRLKGL
  AVTENMRVPHFLQDHGRYMEHLEKIMEVNELTDRELKDLI
• Function: Putative tyrosine carboxypeptidase.

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Putative tyrosine carboxypeptidase MATCAP2 (MATCAP2).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Putative tyrosine carboxypeptidase MATCAP2 (MATCAP2).	[2]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Putative tyrosine carboxypeptidase MATCAP2 (MATCAP2).	[3]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Putative tyrosine carboxypeptidase MATCAP2 (MATCAP2).	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative tyrosine carboxypeptidase MATCAP2 (MATCAP2).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Putative tyrosine carboxypeptidase MATCAP2 (MATCAP2).	[5]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [6] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.