Details of the Drug-Related molecule(s) Interaction Atlas

General Information of Drug (ID: DMN54LS)

Drug Name

HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR Drug Info

Indication

Disease Entry	ICD 11	Status	REF
Discovery agent	N.A.	Investigative	[1]

Cross-matching ID

Molecule-Related Drug Atlas

Molecule Type:

DTT

Drug Status:

Approved Drug(s)

Clinical Trial Drug(s)

Download the Complete Related Drug List

Drug(s) Targeting Glucagon-like peptide 1 receptor (GLP1R)

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Semaglutide	DMAGFOD	Type-2 diabetes	5A11	Approved	[2]
Liraglutide	DM3FXPS	Non-insulin dependent diabetes	5A11	Approved	[3]
Exenatide	DMYHBKN	Inflammation	1A00-CA43.1	Approved	[4]
Dulaglutide	DMYXBV3	Type-2 diabetes	5A11	Approved	[5]
Lixisenatide	DM0QJDC	Type-2 diabetes	5A11	Approved	[6]
Pramlintide	DM0EZ9Q	Type-1/2 diabetes	5A10-5A11	Approved	[3]
Albiglutide	DM1JEGF	Type-2 diabetes	5A11	Approved	[6]
Tirzepatide	DMQNMAT	Type 2 diabetes	5A11	Approved	[7]
Efpeglenatide	DMKA2PI	Type-2 diabetes	5A11	Phase 3	[8]
GLP-1	DMR6YH3	Diabetic complication	5A2Y	Phase 3	[2]
------------------------------------------------------------------------------------


⏷ Show the Full List of 10 Drug(s)

Molecular Interaction Atlas of This Drug

Molecular Interaction Atlas

Download the Complete Interaction Atlas for Visualization in Cytoscape

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Glucagon-like peptide 1 receptor (GLP1R)	TTVIMDE	GLP1R_HUMAN	Inhibitor	[1]

------------------------------------------------------------------------------------

References

1	Search for alpha-helical propensity in the receptor-bound conformation of glucagon-like peptide-1. Bioorg Med Chem. 2008 Dec 1;16(23):10106-12.
2	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 249).
3	Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60.
4	Improved glycemic control and reduction of cardiometabolic risk factors in subjects with type 2 diabetes and metabolic syndrome treated with exenatide in a clinical practice setting. Diabetes TechnolTher. 2009 Jun;11(6):353-9.
5	2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
6	GLP-1 receptor agonists for individualized treatment of type 2 diabetes mellitus.Nat Rev Endocrinol.2012 Dec;8(12):728-42.
7	Dual GIP and GLP-1 Receptor Agonist Tirzepatide Improves Beta-cell Function and Insulin Sensitivity in Type 2 Diabetes. J Clin Endocrinol Metab. 2021 Jan 23;106(2):388-396.
8	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)