Details of the Drug

General Information of Drug (ID: DM4PVDY)

Drug Name

Durvalumab

Indication

Disease Entry	ICD 11	Status	REF
Urothelial carcinoma	2C92.0	Approved	[1], [2]
Hepatocellular carcinoma	2C12.02	Phase 3	[3]
Biliary tract cancer	2C17	Phase 2	[3]
Melanoma	2C30	Phase 2	[3]
Pancreatic ductal carcinoma	2C10.0	Phase 2	[3]
Solid tumour/cancer	2A00-2F9Z	Phase 2	[3]
Diffuse large B-cell lymphoma	2A81	Phase 1	[3]

Drug Type

Monoclonal antibody

Sequence

>heavy chain
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLEWVANIKQDGSEKYY
VDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGWFGELAFDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSRE
EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
EIVLTQSPGTLSLSPGERATLSCRASQRVSSSYLAWYQQKPGQAPRLLIYDASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

ADMET Property

Clearance: The clearance of drug is 8.2 mL/h [4]
Half-life: The concentration or amount of drug in body reduced by one-half in 18 days [4]
Metabolism: The drug is metabolized via reticuloedothelial system or target-mediated disposition [5]
Vd: The volume of distribution (Vd) of drug is 5.64 L [4]

Cross-matching ID

DrugBank ID: DB11714
TTD ID: D0LS9E

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Programmed cell death 1 ligand 1 (PD-L1)	TT8ZLTI	PD1L1_HUMAN	Modulator	[6]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Urothelial carcinoma

ICD Disease Classification

2C92.0

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Programmed cell death 1 ligand 1 (PD-L1)	DTT	CD274	4.38E-07	0.37	2.1

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Durvalumab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Durvalumab and Siponimod.	Multiple sclerosis [8A40]	[16]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Durvalumab and Ocrelizumab.	Multiple sclerosis [8A40]	[17]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Durvalumab and Ozanimod.	Multiple sclerosis [8A40]	[18]
Deflazacort	DMV0RNS	Moderate	Additive immunosuppressive effects by the combination of Durvalumab and Deflazacort.	Muscular dystrophy [8C70]	[19]
-----------

References

1	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2018
2	Durvalumab as third-line or later treatment for advanced non-small-cell lung cancer (ATLANTIC): an open-label, single-arm, phase 2 study.Lancet Oncol. 2018 Apr;19(4):521-536.
3	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
4	FDA Approved Drug Products: IMFINZI (durvalumab) injection, for intravenous use
5	European Medicines Agency: IMFINZI (durvalumab) Summary of Product Characteristics
6	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
7	Antibody-Dependent Cellular Cytotoxicity Activity of a Novel Anti-PD-L1 Antibody Avelumab (MSB0010718C) on Human Tumor Cells. Cancer Immunol Res. 2015 Oct;3(10):1148-57.
8	PD-1 as a potential target in cancer therapy. Cancer Med. 2013 October; 2(5): 662-673.
9	ClinicalTrials.gov (NCT03403777) Avelumab in Refractory Testicular Germ Cell Cancer.. U.S. National Institutes of Health.
10	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
11	Clinical pipeline report, company report or official report of Alphamab Oncology.
12	National Cancer Institute Drug Dictionary (drug id 740856).
13	Targeted immunotherapy for non-small cell lung cancer. World J Clin Oncol. 2014 May 10; 5(2): 39-47.
14	GEMSTONE-301: a phase III clinical trial of CS1001 as consolidation therapy in patients with locally advanced/unresectable (stage III) non-small cell lung cancer (NSCLC) who did not have disease progression after prior concurrent/sequential chemoradiotherapy. Transl Lung Cancer Res. 2020 Oct;9(5):2008-2015.
15	Bintrafusp Alfa, a Bifunctional Fusion Protein Targeting TGF- and PD-L1, in Second-Line Treatment of Patients With NSCLC: Results From an Expansion Cohort of a Phase 1 Trial. J Thorac Oncol. 2020 Jul;15(7):1210-1222.
16	Cerner Multum, Inc. "Australian Product Information.".
17	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
18	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
19	Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".