Details of the Drug

General Information of Drug (ID: DMJTIYK)

Drug Name
Ipilimumab
Synonyms BMS-734016; MDX-010; MDX-101; Yervoy (TN)
Indication
Disease Entry ICD 11 Status REF
Melanoma 2C30 Approved [1], [2], [3]
Drug Type
Monoclonal antibody
Sequence
>heavy chain
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
ADMET Property
Absorption Cmax
The maximum plasma concentration (Cmax) of drug is 65.8 mg/L [4]
Clearance
The clearance of drug is 15.3 mL/h [5]
Half-life
The concentration or amount of drug in body reduced by one-half in 14.7 days [5]
Metabolism
The drug is metabolized via proteolytic enzymes [6]
Vd
The volume of distribution (Vd) of drug is 7.21 L [5]
Cross-matching ID
DrugBank ID
DB06186
TTD ID
D07BVI

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Cytotoxic T-lymphocyte protein 4 (CTLA-4) TTI2S1D CTLA4_HUMAN Not Available [2]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Melanoma
ICD Disease Classification 2C30
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Cytotoxic T-lymphocyte protein 4 (CTLA-4) DTT CTLA4 2.73E-01 0.02 0.05
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Ipilimumab
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Vemurafenib DM62UG5 Moderate Increased risk of hepatotoxicity by the combination of Ipilimumab and Vemurafenib. Melanoma [2C30] [16]
Coadministration of a Drug Treating the Disease Different from Ipilimumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Ipilimumab and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [17]
Bedaquiline DM3906J Moderate Increased risk of hepatotoxicity by the combination of Ipilimumab and Bedaquiline. Antimicrobial drug resistance [MG50-MG52] [18]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Ipilimumab and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [19]
Cannabidiol DM0659E Moderate Increased risk of hepatotoxicity by the combination of Ipilimumab and Cannabidiol. Epileptic encephalopathy [8A62] [20]
Brentuximab vedotin DMWLC57 Moderate Increased risk of hepatotoxicity by the combination of Ipilimumab and Brentuximab vedotin. Hodgkin lymphoma [2B30] [21]
Teriflunomide DMQ2FKJ Major Increased risk of hepatotoxicity by the combination of Ipilimumab and Teriflunomide. Hyper-lipoproteinaemia [5C80] [22]
BMS-201038 DMQTAGO Major Increased risk of hepatotoxicity by the combination of Ipilimumab and BMS-201038. Hyper-lipoproteinaemia [5C80] [23]
Calaspargase pegol DMQZBXI Moderate Increased risk of hepatotoxicity by the combination of Ipilimumab and Calaspargase pegol. Malignant haematopoietic neoplasm [2B33] [24]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Ipilimumab and Idelalisib. Mature B-cell leukaemia [2A82] [25]
Deflazacort DMV0RNS Moderate Additive immunosuppressive effects by the combination of Ipilimumab and Deflazacort. Muscular dystrophy [8C70] [26]
⏷ Show the Full List of 10 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6888).
2 Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
3 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
4 FDA Approved Drug Products: Yervoy Ipilimumab Intravenous Injection
5 Ipilimumab for advanced melanoma: a pharmacologic perspective. J Oncol Pharm Pract. 2013 Sep;19(3):195-201. doi: 10.1177/1078155212459100. Epub 2012 Oct 9.
6 Minder EI, Barman-Aksoezen J, Schneider-Yin X: Pharmacokinetics and Pharmacodynamics of Afamelanotide and its Clinical Use in Treating Dermatologic Disorders. Clin Pharmacokinet. 2017 Aug;56(8):815-823. doi: 10.1007/s40262-016-0501-5.
7 Clinical pipeline report, company report or official report of Alphamab Oncology.
8 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2743).
9 Clinical pipeline report, company report or official report of Akeso Biopharma.
10 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
11 Clinical pipeline report, company report or official report of CytomX Therapeutics.
12 Safety and efficacy of quavonlimab, a novel anti-CTLA-4 antibody (MK-1308), in combination with pembrolizumab in first-line advanced non-small-cell lung cancer. Ann Oncol. 2021 Mar;32(3):395-403.
13 Clinical pipeline report, company report or official report of Xencor.
14 Development and Preliminary Clinical Activity of PD-1-Guided CTLA-4 Blocking Bispecific DART Molecule. Cell Rep Med. 2020 Dec 22;1(9):100163.
15 Clinical pipeline report, company report or official report of SystImmune.
16 Product Information. Yervoy (ipilimumab). Bristol-Myers Squibb, Princeton, NJ.
17 Cerner Multum, Inc. "Australian Product Information.".
18 Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ.
19 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
20 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
21 Product Information. Accolate (zafirlukast). Zeneca Pharmaceuticals, Wilmington, DE.
22 Canadian Pharmacists Association.
23 Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
24 Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500]
25 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
26 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".