Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT03V27)

DTP Name Sodium bicarbonate cotransporter 3 (SLC4A7)
Gene Name SLC4A7
UniProt ID
Q9Y6M7 (S4A7_HUMAN)
VARIDT ID
DTD0387
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
BT; Bicarbonate transporter; Electroneutral Na/HCO(3) cotransporter; NBC2; NBC2B; NBC3; NBCn1; SBC2; SLC4A6; SLC4A7; Sodium bicarbonate cotransporter 2; Sodium bicarbonate cotransporter 2b; Solute carrier family 4 member 7
DTP Family Anion Exchanger (AE) Family ;
Tissue Specificity Highly expressed in testis and spleen. Alsoexpressed in retina, colon, small intestine, ovary, thymus,prostate, muscle, heart and kidney. Isoform 1 is expressed inskeletal muscle and heart muscle.
Sequence
MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHR
HRGHKHHHRRRKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELC
YRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRA
STLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKK
HSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLGHLLPSSRAGTPAGSRCT
TPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHPPEEDLEAALK
GEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQ
YHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKS
VPSQEKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDF
KDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQ
PLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYIT
RFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPSNETLA
QWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGW
IISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGV
MLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMG
LSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLW
KVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPE
SKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFE
DEPRKKYVDAETSL
Function This electroneutral sodium- and bicarbonate-dependent cotransporter with a Na(+):HCO3(-) 1:1 stoichiometry regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia.
Endogenous Substrate(s) Na+
TCDB ID
2.A.31.2.11
Gene ID
9497
Reactome Pathway
RHOD GTPase cycle (R-HSA-9013405 )
RHOQ GTPase cycle (R-HSA-9013406 )
RHOH GTPase cycle (R-HSA-9013407 )
RHOJ GTPase cycle (R-HSA-9013409 )
RHOF GTPase cycle (R-HSA-9035034 )
Bicarbonate transporters (R-HSA-425381 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sodium bicarbonate DMMU6BJ Metabolic acidosis 5C73 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.96E-01 -1.37E-01 -3.55E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.60E-01 -2.55E-02 -1.45E-01
Alopecia ED70 Skin from scalp 7.53E-01 7.67E-02 1.61E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.63E-01 -3.75E-02 -1.40E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.00E-01 -3.12E-01 -5.45E-01
Aortic stenosis BB70 Calcified aortic valve 7.82E-01 -3.55E-02 -9.31E-02
Apnea 7A40 Hyperplastic tonsil 1.53E-01 4.56E-01 9.01E-01
Arthropathy FA00-FA5Z Peripheral blood 4.13E-02 -2.91E-01 -6.45E-01
Asthma CA23 Nasal and bronchial airway 7.68E-01 4.09E-02 8.45E-02
Atopic dermatitis EA80 Skin 1.53E-13 4.45E-01 3.81E+00
Autism 6A02 Whole blood 8.53E-01 -4.28E-02 -1.30E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.89E-01 2.30E-01 1.08E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.89E-02 -2.31E-01 -7.35E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.91E-01 2.18E-02 5.12E-02
Batten disease 5C56.1 Whole blood 5.68E-01 1.66E-02 6.82E-02
Behcet's disease 4A62 Peripheral blood 8.31E-01 -1.73E-01 -5.56E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.69E-01 9.96E-02 3.37E-01
Bladder cancer 2C94 Bladder tissue 7.19E-01 -2.40E-01 -3.82E-01
Breast cancer 2C60-2C6Z Breast tissue 6.43E-04 4.43E-02 7.11E-02
Cardioembolic stroke 8B11.20 Whole blood 2.53E-01 1.17E-01 3.75E-01
Cervical cancer 2C77 Cervical tissue 5.95E-01 3.43E-02 7.96E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.87E-01 8.24E-02 1.01E-01
Chronic hepatitis C 1E51.1 Whole blood 1.49E-02 -2.20E-01 -9.46E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.78E-01 4.10E-02 1.27E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.63E-02 -9.96E-02 -4.02E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.63E-01 1.41E-01 6.45E-01
Colon cancer 2B90 Colon tissue 6.86E-23 3.39E-01 9.85E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.57E-01 -3.08E-01 -6.32E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.50E-02 2.71E-01 6.62E-01
Endometriosis GA10 Endometrium tissue 1.68E-02 -1.19E-01 -1.60E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.15E-01 -4.17E-02 -1.50E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.60E-04 -2.86E-01 -1.14E+00
Gastric cancer 2B72 Gastric tissue 1.32E-01 5.46E-01 1.64E+00
Glioblastopma 2A00.00 Nervous tissue 4.08E-133 7.56E-01 2.01E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.50E-03 4.34E-01 6.72E-01
Head and neck cancer 2D42 Head and neck tissue 9.01E-13 3.64E-01 1.17E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.37E-01 -7.40E-02 -5.81E-01
Huntington's disease 8A01.10 Whole blood 1.63E-01 -1.82E-01 -1.06E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.01E-01 5.89E-02 8.32E-02
Immunodeficiency 4A00-4A20 Peripheral blood 8.11E-02 -9.75E-02 -5.68E-01
Influenza 1.00E+30 Whole blood 7.72E-04 -1.98E+00 -6.91E+00
Interstitial cystitis GC00.3 Bladder tissue 4.26E-02 2.06E-01 7.44E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.91E-03 -5.10E-01 -1.20E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.11E-01 1.34E-01 3.66E-01
Ischemic stroke 8B11 Peripheral blood 9.77E-01 -4.45E-04 -1.25E-03
Juvenile idiopathic arthritis FA24 Peripheral blood 5.09E-03 2.48E-01 4.04E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.27E-01 1.02E-01 4.43E-01
Lateral sclerosis 8B60.4 Skin 3.61E-01 -2.96E-01 -4.74E-01
Liver cancer 2C12.0 Liver tissue 1.10E-09 2.27E-01 1.18E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.33E-02 4.40E-01 1.55E+00
Lung cancer 2C25 Lung tissue 2.39E-16 2.88E-01 8.51E-01
Lupus erythematosus 4A40 Whole blood 5.52E-07 -6.39E-02 -2.69E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.44E-01 -4.20E-02 -6.83E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.26E-01 4.85E-02 1.69E-01
Melanoma 2C30 Skin 7.84E-01 -3.45E-01 -3.56E-01
Multiple myeloma 2A83.1 Bone marrow 2.51E-02 -2.62E-01 -1.15E+00
Multiple myeloma 2A83.1 Peripheral blood 2.54E-01 -2.18E-01 -3.83E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.92E-01 -1.23E-01 -2.96E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.43E-06 -2.20E-01 -8.06E-01
Myelofibrosis 2A20.2 Whole blood 3.33E-01 -8.54E-02 -4.63E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.07E-02 -3.82E-01 -5.19E-01
Myopathy 8C70.6 Muscle tissue 1.71E-01 1.25E-01 2.43E-01
Neonatal sepsis KA60 Whole blood 3.79E-13 -4.40E-01 -7.81E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.75E-06 7.26E-01 2.68E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.59E-01 3.31E-02 6.00E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.11E-01 4.20E-01 5.04E-01
Olive pollen allergy CA08.00 Peripheral blood 2.35E-01 -1.61E-01 -6.05E-01
Oral cancer 2B6E Oral tissue 5.66E-03 2.26E-01 3.88E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.70E-01 2.23E-01 8.81E-01
Osteoporosis FB83.1 Bone marrow 4.43E-01 1.78E-01 5.56E-01
Ovarian cancer 2C73 Ovarian tissue 4.23E-03 5.04E-01 1.46E+00
Pancreatic cancer 2C10 Pancreas 1.25E-01 1.90E-01 4.28E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.25E-01 -9.73E-02 -3.32E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.30E-05 -4.40E-01 -1.74E+00
Pituitary cancer 2D12 Pituitary tissue 4.47E-01 -9.79E-02 -1.92E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.75E-01 -1.09E-01 -2.13E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.69E-02 -1.70E-01 -8.16E-01
Polycythemia vera 2A20.4 Whole blood 1.57E-10 -2.35E-01 -1.33E+00
Pompe disease 5C51.3 Biceps muscle 4.80E-01 -1.22E-01 -2.80E-01
Preterm birth KA21.4Z Myometrium 7.33E-01 -5.60E-02 -3.46E-01
Prostate cancer 2C82 Prostate 1.56E-05 4.58E-01 1.11E+00
Psoriasis EA90 Skin 8.68E-03 1.38E-01 3.43E-01
Rectal cancer 2B92 Rectal colon tissue 3.91E-07 5.01E-01 3.87E+00
Renal cancer 2C90-2C91 Kidney 8.50E-02 2.11E-01 3.78E-01
Retinoblastoma 2D02.2 Uvea 1.11E-12 -3.88E+00 -6.10E+00
Rheumatoid arthritis FA20 Synovial tissue 2.23E-07 5.99E-01 2.78E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.57E-01 2.41E-02 1.32E-01
Schizophrenia 6A20 Prefrontal cortex 3.63E-01 1.30E-01 2.43E-01
Schizophrenia 6A20 Superior temporal cortex 3.06E-01 -5.24E-03 -7.16E-02
Scleroderma 4A42.Z Whole blood 8.67E-01 -5.84E-02 -3.30E-01
Seizure 8A60-8A6Z Whole blood 1.28E-01 2.88E-01 7.60E-01
Sensitive skin EK0Z Skin 5.56E-01 6.88E-02 4.92E-01
Sepsis with septic shock 1G41 Whole blood 6.26E-32 -5.48E-01 -9.38E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.35E-01 -1.25E-01 -1.98E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.11E-03 -2.63E-01 -6.14E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.89E-01 2.79E-05 1.69E-04
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.43E-01 4.31E-02 2.19E-01
Skin cancer 2C30-2C3Z Skin 9.12E-36 7.09E-01 1.40E+00
Thrombocythemia 3B63 Whole blood 2.10E-03 -1.54E-01 -8.72E-01
Thrombocytopenia 3B64 Whole blood 5.82E-01 -1.23E-01 -1.83E-01
Thyroid cancer 2D10 Thyroid 3.46E-12 2.59E-01 7.56E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.69E-01 3.61E-02 6.81E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.20E-01 1.68E-02 7.69E-02
Type 2 diabetes 5A11 Liver tissue 1.15E-01 5.94E-02 6.85E-01
Ureter cancer 2C92 Urothelium 7.37E-01 -3.07E-02 -1.85E-01
Uterine cancer 2C78 Endometrium tissue 6.43E-01 1.84E-01 2.77E-01
Vitiligo ED63.0 Skin 6.22E-03 3.97E-01 1.31E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The sodium bicarbonate cotransporter: structure, function, and regulation. Semin Nephrol. 2006 Sep;26(5):352-60.