Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT2EGUN)

DTP Name Putative sodium-coupled neutral amino acid transporter 7 (SLC38A7)
Gene Name SLC38A7
UniProt ID
Q9NVC3 (S38A7_HUMAN)
VARIDT ID
DTD0334
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC38A7; SNAT7; Solute carrier family 38 member 7
DTP Family Amino Acid/Auxin Permease (AAAP) Family ;
Sequence
MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTSTLGAIFIV
VNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVW
AVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTI
SLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVTAIVIIKYIWPDKEMTPGNILTRPAS
WMAVFNAMPTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFL
TFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVE
EDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLS
EMEEVKPASWWVLVSYGVLLVTLGAFIFGQTTANAIFVDLLA
Function This transporter mediates sodium-dependent transport of amino acids, preferentially L-glutamine.
Endogenous Substrate(s) L-glutamine
TCDB ID
2.A.18.6.13
Gene ID
55238

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Anastrozole DMNP60F Breast cancer 2C60-2C65 Approved [1]
L-glutamine DM69G8X Short bowel syndrome KB89.1 Approved [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.21E-03 9.29E-02 4.01E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.39E-07 4.31E-01 1.55E+00
Alopecia ED70 Skin from scalp 8.78E-04 -1.98E-01 -9.83E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.69E-07 -1.26E-01 -7.50E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.83E-01 1.99E-01 8.89E-01
Aortic stenosis BB70 Calcified aortic valve 8.52E-02 1.65E-01 1.14E+00
Apnea 7A40 Hyperplastic tonsil 2.05E-02 -3.62E-01 -1.86E+00
Arthropathy FA00-FA5Z Peripheral blood 4.78E-01 -1.92E-01 -8.53E-01
Asthma CA23 Nasal and bronchial airway 1.37E-04 2.64E-01 4.12E-01
Atopic dermatitis EA80 Skin 4.87E-20 6.67E-01 6.22E+00
Autism 6A02 Whole blood 4.40E-01 -6.60E-02 -3.12E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.39E-01 3.80E-01 1.15E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.60E-02 1.71E-01 1.12E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.99E-06 1.74E-01 7.17E-01
Batten disease 5C56.1 Whole blood 4.06E-01 3.81E-02 2.36E-01
Behcet's disease 4A62 Peripheral blood 9.08E-01 -9.61E-02 -3.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.41E-01 -4.22E-02 -2.69E-01
Bladder cancer 2C94 Bladder tissue 6.86E-05 6.67E-01 3.14E+00
Breast cancer 2C60-2C6Z Breast tissue 1.39E-48 3.46E-01 1.21E+00
Cardioembolic stroke 8B11.20 Whole blood 1.67E-02 1.04E-01 5.60E-01
Cervical cancer 2C77 Cervical tissue 2.38E-01 -1.36E-02 -3.76E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.87E-01 4.39E-02 1.54E-01
Chronic hepatitis C 1E51.1 Whole blood 6.62E-02 -6.13E-02 -1.10E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 2.90E-01 -1.04E-01 -3.54E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.16E-01 8.32E-02 3.62E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.11E-02 2.18E-01 2.38E+00
Colon cancer 2B90 Colon tissue 3.15E-55 4.75E-01 1.71E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.17E-01 5.74E-02 2.48E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.84E-01 1.71E-01 5.10E-01
Endometriosis GA10 Endometrium tissue 8.07E-01 1.37E-02 2.68E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.47E-01 -2.76E-02 -2.11E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.35E-06 7.67E-01 2.63E+00
Gastric cancer 2B72 Gastric tissue 8.61E-03 2.80E-01 4.11E+00
Glioblastopma 2A00.00 Nervous tissue 1.01E-07 -1.47E-01 -4.70E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.50E-04 7.92E-01 1.71E+00
Head and neck cancer 2D42 Head and neck tissue 1.54E-23 4.27E-01 1.67E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.13E-01 1.12E-01 6.10E-01
Huntington's disease 8A01.10 Whole blood 5.91E-01 1.26E-03 5.38E-03
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.33E-02 2.81E-01 9.50E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.80E-01 2.37E-02 1.81E-01
Influenza 1.00E+30 Whole blood 1.77E-02 -6.73E-01 -3.03E+00
Interstitial cystitis GC00.3 Bladder tissue 5.20E-02 4.47E-01 1.71E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.13E-03 1.06E+00 1.86E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.63E-01 -7.87E-02 -2.58E-01
Ischemic stroke 8B11 Peripheral blood 1.50E-01 -1.71E-01 -6.45E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.02E-05 -1.29E-01 -3.34E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.32E-03 5.39E-01 2.68E+00
Lateral sclerosis 8B60.4 Skin 8.79E-01 4.48E-02 2.02E-01
Liver cancer 2C12.0 Liver tissue 3.11E-05 4.40E-01 1.01E+00
Liver failure DB99.7-DB99.8 Liver tissue 6.61E-04 5.86E-01 1.65E+00
Lung cancer 2C25 Lung tissue 8.94E-50 5.22E-01 1.51E+00
Lupus erythematosus 4A40 Whole blood 7.60E-02 -1.55E-02 -6.54E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.94E-01 4.55E-02 1.71E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.43E-01 -2.84E-02 -1.75E-01
Melanoma 2C30 Skin 6.38E-05 8.47E-01 1.31E+00
Multiple myeloma 2A83.1 Bone marrow 1.41E-01 -7.47E-02 -3.99E-01
Multiple myeloma 2A83.1 Peripheral blood 2.41E-01 6.90E-02 4.94E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.88E-01 -3.04E-02 -1.17E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.38E-03 1.42E-01 5.75E-01
Myelofibrosis 2A20.2 Whole blood 6.86E-01 4.00E-02 3.26E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.43E-01 1.12E-02 3.40E-02
Myopathy 8C70.6 Muscle tissue 8.21E-01 -6.14E-02 -2.75E-01
Neonatal sepsis KA60 Whole blood 5.31E-01 -8.79E-02 -4.57E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.90E-01 -1.03E-01 -6.12E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 7.30E-02 -3.15E-01 -1.49E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.01E-02 1.74E-01 1.59E+00
Olive pollen allergy CA08.00 Peripheral blood 6.20E-01 2.42E-02 4.18E-02
Oral cancer 2B6E Oral tissue 4.21E-07 2.88E-01 1.10E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.09E-01 6.36E-01 9.58E-01
Osteoporosis FB83.1 Bone marrow 5.22E-01 4.49E-01 2.84E+00
Ovarian cancer 2C73 Ovarian tissue 2.40E-03 2.90E-01 1.32E+00
Pancreatic cancer 2C10 Pancreas 8.01E-05 4.74E-01 1.21E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.07E-02 -2.39E-01 -8.91E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.21E-02 1.56E-01 7.71E-01
Pituitary cancer 2D12 Pituitary tissue 2.35E-01 4.85E-02 2.07E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.22E-01 2.11E-01 8.26E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.04E-01 -2.08E-02 -1.59E-01
Polycythemia vera 2A20.4 Whole blood 2.04E-01 -5.63E-02 -4.53E-01
Pompe disease 5C51.3 Biceps muscle 1.99E-03 5.71E-01 3.38E+00
Preterm birth KA21.4Z Myometrium 1.45E-01 -2.93E-01 -6.95E-01
Prostate cancer 2C82 Prostate 6.32E-03 -2.90E-01 -9.36E-01
Psoriasis EA90 Skin 8.69E-07 1.62E-01 6.06E-01
Rectal cancer 2B92 Rectal colon tissue 4.37E-05 3.46E-01 3.46E+00
Renal cancer 2C90-2C91 Kidney 6.61E-01 -4.30E-02 -2.74E-01
Retinoblastoma 2D02.2 Uvea 1.03E-06 1.12E+00 6.01E+00
Rheumatoid arthritis FA20 Synovial tissue 6.40E-05 7.73E-01 3.66E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.51E-01 -3.53E-02 -1.82E-01
Schizophrenia 6A20 Prefrontal cortex 5.75E-01 -4.51E-02 -2.59E-01
Schizophrenia 6A20 Superior temporal cortex 6.17E-01 3.26E-03 3.12E-02
Scleroderma 4A42.Z Whole blood 8.21E-01 3.59E-02 2.06E-01
Seizure 8A60-8A6Z Whole blood 8.80E-01 -1.24E-02 -6.55E-02
Sensitive skin EK0Z Skin 3.13E-02 2.58E-01 1.34E+00
Sepsis with septic shock 1G41 Whole blood 1.21E-03 -8.78E-02 -4.55E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.27E-01 5.55E-03 4.50E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.41E-02 1.20E-01 9.89E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.56E-01 -3.22E-01 -1.08E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.37E-01 9.24E-02 7.60E-01
Skin cancer 2C30-2C3Z Skin 1.81E-52 7.06E-01 2.39E+00
Thrombocythemia 3B63 Whole blood 2.70E-01 -6.05E-02 -4.67E-01
Thrombocytopenia 3B64 Whole blood 3.49E-01 4.95E-01 5.49E-01
Thyroid cancer 2D10 Thyroid 3.06E-04 5.03E-02 1.58E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.64E-01 4.15E-01 7.18E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.02E-01 2.65E-01 9.73E-01
Type 2 diabetes 5A11 Liver tissue 3.59E-01 -8.32E-02 -3.52E-01
Ureter cancer 2C92 Urothelium 8.44E-01 1.24E-01 3.69E-01
Uterine cancer 2C78 Endometrium tissue 1.06E-03 -3.53E-02 -5.79E-02
Vitiligo ED63.0 Skin 4.33E-02 -1.22E-01 -9.32E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 38 member 7 (SLC38A7) DTT Info
DTP DTT Type Literature-reported

References

1 Anastrozole Aromatase Inhibitor Plasma Drug Concentration Genome-Wide Association Study: Functional Epistatic Interaction Between SLC38A7 and ALPPL2. Clin Pharmacol Ther. 2019 Jan 16.
2 Identification of SLC38A7 (SNAT7) protein as a glutamine transporter expressed in neurons. J Biol Chem. 2011 Jun 10;286(23):20500-11.