General Information of Drug Transporter (DTP) (ID: DT342ZG)

DTP Name Monocarboxylate transporter 1 (SLC16A1)
Gene Name SLC16A1
UniProt ID
P53985 (MOT1_HUMAN)
VARIDT ID
DTD0100
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms HHF7; MCT; MCT 1; MCT1; MCT1D; SLC16A1; Solute carrier family 16 member 1; hMCT1
DTP Family Major Facilitator Superfamily (MFS)
Monocarboxylate Transporter (MCT) Family
Tissue Specificity Detected in heart and in blood lymphocytes andmonocytes (at protein level). Widely expressed.
Sequence
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSW
ISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIG
GLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLI
LGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQ
EKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYA
GFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKA
AESPDQKDTDGGPKEEESPV
Function
This proton-coupled transporter can mediates the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Depending on the tissue and on cicumstances, mediates the import or export of lactic acid and ketone bodies. Required for normal nutrient assimilation, increase of white adipose tissue and body weight gain when on a high-fat diet. Plays a role in cellular responses to a high-fat diet by modulating the cellular levels of lactate and pyruvate, small molecules that contribute to the regulation of central metabolic pathways and insulin secretion, with concomitant effects on plasma insulin levels and blood glucose homeostasis.
Endogenous Substrate(s) Monocarboxylates
TCDB ID
2.A.1.13.1
Gene ID
6566
Reactome Pathway
Proton-coupled monocarboxylate transport (R-HSA-433692 )
Defective SLC16A1 causes symptomatic deficiency in lactate transport (SDLT) (R-HSA-5619070 )
Pyruvate metabolism (R-HSA-70268 )
Aspirin ADME (R-HSA-9749641 )
Basigin interactions (R-HSA-210991 )
BioCyc Pathway
MetaCyc:ENSG00000155380-MON

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
5 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Atorvastatin DMF28YC Acute coronary syndrome BA41 Approved [1]
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [2]
Gamma Hydroxybutyric Acid DMGBKVD Narcolepsy 7A20 Approved [3]
Pyruvic acid DM7Q41G Malnutrition 5B50-5B71 Approved [4]
Salicyclic acid DM2F8XZ Acne vulgaris ED80 Approved [1]
------------------------------------------------------------------------------------
1 Clinical Trial Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Gabapentin enacarbil DMJY2TM Postherpetic neuralgia 1E91.5 Phase 2 [5]
------------------------------------------------------------------------------------
5 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
biotin DMKMCE1 Discovery agent N.A. Investigative [6]
Butanoic Acid DMTAJP7 Discovery agent N.A. Investigative [5]
Hydroxyacetic Acid DMQFBH6 Discovery agent N.A. Investigative [7]
Milchsaure DM462BT Pruritus EC90 Investigative [8]
Pyroglutamic Acid DMROZUA Discovery agent N.A. Investigative [9]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.74E-02 1.15E-03 3.19E-03
Adrenocortical carcinoma 2D11.Z Kidney 2.54E-05 2.76E-01 7.51E-01
Alopecia ED70 Skin from scalp 7.87E-01 2.29E-05 5.36E-05
Alzheimer's disease 8A20 Entorhinal cortex 2.27E-02 4.13E-01 6.05E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.78E-01 -3.25E-02 -8.35E-02
Aortic stenosis BB70 Calcified aortic valve 2.90E-01 -1.32E-01 -4.22E-01
Apnea 7A40 Hyperplastic tonsil 8.21E-03 -9.41E-01 -1.54E+00
Arthropathy FA00-FA5Z Peripheral blood 3.09E-02 -1.75E-01 -6.88E-01
Asthma CA23 Nasal and bronchial airway 4.96E-05 3.95E-01 6.42E-01
Atopic dermatitis EA80 Skin 2.67E-03 3.11E-01 1.06E+00
Autism 6A02 Whole blood 3.28E-01 -1.38E-01 -4.61E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.37E-01 -2.22E-01 -7.39E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.08E-01 5.63E-02 2.74E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.95E-01 2.12E-01 4.56E-01
Batten disease 5C56.1 Whole blood 2.16E-01 5.39E-02 2.62E-01
Behcet's disease 4A62 Peripheral blood 8.42E-01 1.30E-01 3.21E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.75E-02 2.62E-01 5.08E-01
Bladder cancer 2C94 Bladder tissue 4.93E-02 5.53E-01 6.83E-01
Breast cancer 2C60-2C6Z Breast tissue 7.28E-01 -2.66E-01 -4.63E-01
Cardioembolic stroke 8B11.20 Whole blood 5.37E-06 6.20E-01 1.26E+00
Cervical cancer 2C77 Cervical tissue 4.23E-04 5.77E-01 7.73E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.37E-01 2.53E-02 5.76E-02
Chronic hepatitis C 1E51.1 Whole blood 2.28E-01 -1.79E-01 -6.64E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.59E-01 -1.23E-03 -3.26E-03
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.26E-01 4.05E-02 2.23E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.28E-01 3.15E-01 9.11E-01
Colon cancer 2B90 Colon tissue 8.00E-13 -7.07E-01 -7.63E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.00E-01 3.33E-02 3.15E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.44E-01 5.13E-02 1.41E-01
Endometriosis GA10 Endometrium tissue 1.17E-01 -6.12E-01 -9.72E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.48E-01 1.97E-02 5.95E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.39E-04 6.49E-01 2.64E+00
Gastric cancer 2B72 Gastric tissue 1.12E-01 6.72E-01 1.88E+00
Glioblastopma 2A00.00 Nervous tissue 3.00E-80 1.11E+00 1.60E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.28E-04 6.79E-01 1.69E+00
Head and neck cancer 2D42 Head and neck tissue 4.68E-65 2.96E+00 3.93E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.34E-01 2.55E-01 4.16E-01
Huntington's disease 8A01.10 Whole blood 8.69E-01 -6.60E-02 -5.80E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.12E-01 -1.82E-01 -2.70E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.26E-05 5.12E-01 8.36E+00
Influenza 1.00E+30 Whole blood 1.28E-04 -1.37E+00 -6.13E+00
Interstitial cystitis GC00.3 Bladder tissue 5.03E-02 4.69E-01 1.21E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.13E-03 5.61E-01 1.08E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.09E-01 -1.15E-01 -2.16E-01
Ischemic stroke 8B11 Peripheral blood 5.04E-01 -9.56E-02 -3.62E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.29E-03 2.26E-01 3.21E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.16E-01 -2.79E-01 -4.77E-01
Lateral sclerosis 8B60.4 Skin 4.89E-01 6.25E-02 2.14E-01
Liver cancer 2C12.0 Liver tissue 7.42E-01 2.57E-02 3.76E-02
Liver failure DB99.7-DB99.8 Liver tissue 3.57E-03 -1.24E+00 -1.83E+00
Lung cancer 2C25 Lung tissue 6.42E-35 3.17E-01 6.92E-01
Lupus erythematosus 4A40 Whole blood 3.35E-01 2.26E-01 2.82E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.27E-01 3.92E-03 8.85E-03
Major depressive disorder 6A70-6A7Z Hippocampus 1.90E-01 6.86E-02 1.47E-01
Melanoma 2C30 Skin 7.97E-03 3.42E-01 5.24E-01
Multiple myeloma 2A83.1 Bone marrow 8.52E-06 8.18E-01 3.67E+00
Multiple myeloma 2A83.1 Peripheral blood 3.14E-01 -5.95E-01 -9.39E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.02E-01 -3.79E-01 -4.77E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.33E-01 1.14E-01 2.04E-01
Myelofibrosis 2A20.2 Whole blood 1.76E-02 6.46E-01 4.33E+00
Myocardial infarction BA41-BA50 Peripheral blood 9.46E-01 -1.54E-01 -1.27E-01
Myopathy 8C70.6 Muscle tissue 5.67E-02 -1.19E-01 -4.39E-01
Neonatal sepsis KA60 Whole blood 1.71E-02 5.10E-02 1.24E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.04E-05 1.74E+00 2.79E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.97E-01 -2.35E-01 -4.50E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.17E-02 -3.75E-01 -7.38E-01
Olive pollen allergy CA08.00 Peripheral blood 3.98E-01 -1.64E-01 -3.11E-01
Oral cancer 2B6E Oral tissue 3.43E-10 1.66E+00 1.72E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.98E-01 1.26E-01 1.35E-01
Osteoporosis FB83.1 Bone marrow 4.46E-01 -2.31E-01 -8.01E-01
Ovarian cancer 2C73 Ovarian tissue 5.11E-01 4.06E-01 5.41E-01
Pancreatic cancer 2C10 Pancreas 1.34E-03 5.89E-01 7.09E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.45E-01 2.60E-01 5.67E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.36E-02 1.01E-01 3.74E-01
Pituitary cancer 2D12 Pituitary tissue 1.79E-02 5.42E-01 1.01E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.97E-02 8.15E-01 1.31E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.89E-01 -2.81E-01 -6.15E-01
Polycythemia vera 2A20.4 Whole blood 1.52E-03 3.69E-02 2.43E-01
Pompe disease 5C51.3 Biceps muscle 7.80E-02 -4.56E-01 -1.25E+00
Preterm birth KA21.4Z Myometrium 7.79E-03 1.71E+00 2.01E+00
Prostate cancer 2C82 Prostate 1.59E-05 2.21E+00 1.89E+00
Psoriasis EA90 Skin 2.20E-28 1.45E+00 2.18E+00
Rectal cancer 2B92 Rectal colon tissue 4.14E-01 -6.59E-01 -6.36E-01
Renal cancer 2C90-2C91 Kidney 5.79E-05 2.61E+00 2.38E+00
Retinoblastoma 2D02.2 Uvea 1.31E-04 -1.66E+00 -2.86E+00
Rheumatoid arthritis FA20 Synovial tissue 2.86E-01 -1.74E-01 -1.76E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.83E-02 4.55E-02 2.52E-01
Schizophrenia 6A20 Prefrontal cortex 1.93E-01 5.79E-02 1.09E-01
Schizophrenia 6A20 Superior temporal cortex 5.25E-01 4.22E-02 6.53E-02
Scleroderma 4A42.Z Whole blood 4.57E-01 -1.19E-01 -5.97E-01
Seizure 8A60-8A6Z Whole blood 7.56E-01 -1.21E-01 -2.40E-01
Sensitive skin EK0Z Skin 6.63E-01 0.00E+00 0.00E+00
Sepsis with septic shock 1G41 Whole blood 7.73E-07 9.01E-02 3.03E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.03E-01 2.34E-01 6.14E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.63E-02 2.26E-01 9.93E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.66E-02 8.47E-01 2.46E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.65E-01 1.94E-01 5.92E-01
Skin cancer 2C30-2C3Z Skin 6.77E-71 1.80E+00 2.46E+00
Thrombocythemia 3B63 Whole blood 1.89E-01 7.19E-02 4.78E-01
Thrombocytopenia 3B64 Whole blood 5.50E-01 -4.53E-01 -3.70E-01
Thyroid cancer 2D10 Thyroid 4.03E-19 3.97E-01 9.15E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.81E-01 -3.11E-01 -4.05E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.49E-02 8.22E-01 1.87E+00
Type 2 diabetes 5A11 Liver tissue 4.70E-01 -1.15E-01 -2.35E-01
Ureter cancer 2C92 Urothelium 9.32E-01 -4.53E-02 -2.13E-01
Uterine cancer 2C78 Endometrium tissue 3.49E-01 1.53E-01 1.58E-01
Vitiligo ED63.0 Skin 3.39E-01 -6.90E-02 -2.09E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

Drug Affinity of This DTP Assessed by Cell Line

Investigative Drug(s)
Drug Name Highest Status Cell Line Affinity REF
Pyroglutamic Acid Investigative Oocytes-MCT1 Km = 4.0 microM [9]

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Monocarboxylate transporter 1 (SLC16A1) DTT Info
DTP DTT Type Literature-reported

References

1 H+-coupled nutrient, micronutrient and drug transporters in the mammalian small intestine. Exp Physiol. 2007 Jul;92(4):603-19.
2 Circadian rhythms in gene expression: Relationship to physiology, disease, drug disposition and drug action. Adv Drug Deliv Rev. 2010 Jul 31;62(9-10):904-17.
3 Flavonoids modulate monocarboxylate transporter-1-mediated transport of gamma-hydroxybutyrate in vitro and in vivo. Drug Metab Dispos. 2007 Feb;35(2):201-8.
4 AR-C155858 is a potent inhibitor of monocarboxylate transporters MCT1 and MCT2 that binds to an intracellular site involving transmembrane helices 7-10. Biochem J. 2010 Jan 15;425(3):523-30.
5 Overview of the proton-coupled MCT (SLC16A) family of transporters: characterization, function and role in the transport of the drug of abuse gamma-hydroxybutyric acid. AAPS J. 2008 Jun;10(2):311-21.
6 Biotin. Biofactors. 2009 Jan-Feb;35(1):36-46.
7 Cidofovir peptide conjugates as prodrugs. Journal of Organometallic Chemistry, 2005, 690(10):2673-2678.
8 Distribution of monocarboxylate transporters MCT1-MCT8 in rat tissues and human skeletal muscle. Appl Physiol Nutr Metab. 2006 Feb;31(1):31-9.
9 Interaction of atorvastatin with the human glial transporter SLC16A1. Eur J Pharmacol. 2016 Oct 5;788:248-254.