Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT7NVLY)

DTP Name Zinc transporter 8 (SLC30A8)
Gene Name SLC30A8
UniProt ID
Q8IWU4 (ZNT8_HUMAN)
VARIDT ID
DTD0035
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC30A8; Solute carrier family 30 member 8; ZNT8; ZnT-8
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Tissue Specificity In the endocrine pancreas, expressed ininsulin-producing beta cells. Expressed at relatively high levelsin subcutaneous fat tissue from lean persons; much lower levels invisceral fat, whether from lean or obese individuals, and insubcutaneous fat tissue from obese individuals. Expressed inperipheral blood mononuclear cells, including T-cells and B-cells,with great variation among individuals ranging from negative tostrongly positive.
Sequence
MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPT
EKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFS
LWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMII
VSSCAVAANIVLTVVLHQRCLGHNHKEVQANASVRAAFVHALGDLFQSISVLISALIIYF
KPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSV
HSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPD
CLFCEDPCD
Function
This transporter may be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells. Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.3.5
Gene ID
169026
Reactome Pathway
Zinc efflux and compartmentalization by the SLC30 family (R-HSA-435368 )
Insulin processing (R-HSA-264876 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.82E-01 -9.16E-03 -6.39E-02
Adrenocortical carcinoma 2D11.Z Kidney 2.70E-01 -3.36E-02 -2.32E-01
Alopecia ED70 Skin from scalp 6.76E-01 -6.36E-03 -2.08E-02
Alzheimer's disease 8A20 Entorhinal cortex 4.15E-01 -1.66E-02 -1.24E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.42E-01 -4.40E-02 -3.53E-01
Aortic stenosis BB70 Calcified aortic valve 6.43E-01 -1.06E-01 -1.55E-01
Apnea 7A40 Hyperplastic tonsil 2.25E-01 -6.90E-02 -4.18E-01
Arthropathy FA00-FA5Z Peripheral blood 7.65E-01 -7.70E-03 -7.50E-02
Asthma CA23 Nasal and bronchial airway 8.09E-02 -7.58E-02 -2.54E-01
Atopic dermatitis EA80 Skin 4.23E-02 3.54E-02 4.82E-01
Autism 6A02 Whole blood 2.93E-01 -3.97E-02 -2.58E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.41E-01 -7.14E-02 -3.97E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.79E-01 -2.85E-02 -4.48E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.31E-02 -9.81E-02 -3.16E-01
Batten disease 5C56.1 Whole blood 5.60E-01 5.46E-02 6.02E-01
Behcet's disease 4A62 Peripheral blood 9.85E-01 3.96E-02 1.99E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.74E-01 -3.87E-02 -2.20E-01
Bladder cancer 2C94 Bladder tissue 6.80E-07 6.77E-01 5.56E+00
Breast cancer 2C60-2C6Z Breast tissue 2.03E-35 4.47E-02 1.47E-01
Cardioembolic stroke 8B11.20 Whole blood 1.47E-01 -1.24E-01 -4.72E-01
Cervical cancer 2C77 Cervical tissue 2.60E-02 -1.49E-01 -7.08E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.52E-01 2.96E-02 1.59E-01
Chronic hepatitis C 1E51.1 Whole blood 3.95E-01 1.04E-01 6.06E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.50E-02 1.50E-01 7.21E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.70E-01 3.60E-02 2.93E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.22E-01 4.11E-02 3.07E-01
Colon cancer 2B90 Colon tissue 1.11E-05 -8.70E-02 -4.23E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.77E-01 -1.46E-01 -1.43E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.22E-01 -2.83E-02 -1.95E-01
Endometriosis GA10 Endometrium tissue 1.51E-01 1.07E-01 4.99E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.81E-01 -2.78E-02 -2.44E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.78E-01 1.96E-02 1.29E-01
Gastric cancer 2B72 Gastric tissue 3.36E-01 -2.60E-01 -1.33E+00
Glioblastopma 2A00.00 Nervous tissue 4.86E-01 4.72E-02 1.65E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.84E-01 -2.97E-01 -1.97E+00
Head and neck cancer 2D42 Head and neck tissue 9.06E-01 -2.64E-02 -1.61E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.43E-01 -7.01E-02 -3.41E-01
Huntington's disease 8A01.10 Whole blood 6.37E-01 -8.70E-03 -1.26E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.76E-01 -7.13E-02 -3.22E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.95E-01 -3.09E-02 -4.88E-01
Influenza 1.00E+30 Whole blood 2.00E-01 3.28E-01 2.61E+00
Interstitial cystitis GC00.3 Bladder tissue 4.65E-01 -2.81E-02 -4.82E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.02E-01 -1.13E-02 -8.15E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.31E-01 -1.38E-01 -4.72E-01
Ischemic stroke 8B11 Peripheral blood 8.46E-01 1.30E-02 1.10E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.51E-01 1.26E-02 8.02E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.99E-01 5.89E-02 5.42E-01
Lateral sclerosis 8B60.4 Skin 6.26E-01 5.77E-03 3.76E-02
Liver cancer 2C12.0 Liver tissue 7.18E-03 -1.70E-01 -8.69E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.39E-01 -1.87E-01 -8.57E-01
Lung cancer 2C25 Lung tissue 4.24E-02 8.80E-03 4.61E-02
Lupus erythematosus 4A40 Whole blood 9.49E-02 1.47E-02 5.86E-02
Major depressive disorder 6A70-6A7Z Whole blood 6.68E-01 3.88E-02 1.50E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.86E-01 1.36E-02 7.57E-02
Melanoma 2C30 Skin 1.79E-01 -3.46E-01 -7.28E-01
Multiple myeloma 2A83.1 Bone marrow 3.24E-06 -5.72E-01 -4.72E+00
Multiple myeloma 2A83.1 Peripheral blood 1.62E-01 1.04E-01 6.79E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.12E-01 7.08E-02 2.03E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.32E-01 7.85E-02 3.68E-01
Myelofibrosis 2A20.2 Whole blood 5.71E-02 2.45E-02 2.82E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.95E-01 -2.94E-02 -6.37E-02
Myopathy 8C70.6 Muscle tissue 1.67E-01 -1.47E-01 -7.65E-01
Neonatal sepsis KA60 Whole blood 2.25E-01 4.10E-02 3.07E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.78E-03 -5.11E-01 -1.56E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.01E-02 -1.09E-01 -9.66E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.80E-01 1.83E-02 1.67E-01
Olive pollen allergy CA08.00 Peripheral blood 8.94E-01 6.90E-02 3.87E-01
Oral cancer 2B6E Oral tissue 2.41E-02 -2.63E-01 -9.04E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.01E-01 -1.21E-01 -4.76E-01
Osteoporosis FB83.1 Bone marrow 5.77E-02 1.18E-01 1.57E+00
Ovarian cancer 2C73 Ovarian tissue 8.33E-01 -7.55E-02 -3.47E-01
Pancreatic cancer 2C10 Pancreas 3.74E-01 -4.95E-01 -2.92E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.33E-01 -6.77E-03 -4.44E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.82E-02 -1.03E-01 -7.03E-01
Pituitary cancer 2D12 Pituitary tissue 4.58E-01 1.13E-02 5.19E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.60E-01 -1.51E-02 -6.85E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.45E-01 3.43E-02 2.55E-01
Polycythemia vera 2A20.4 Whole blood 1.02E-01 1.38E-02 1.75E-01
Pompe disease 5C51.3 Biceps muscle 1.30E-01 -7.06E-02 -6.76E-01
Preterm birth KA21.4Z Myometrium 1.26E-01 -1.25E-01 -7.59E-01
Prostate cancer 2C82 Prostate 8.71E-02 -2.48E-01 -5.29E-01
Psoriasis EA90 Skin 2.85E-03 -9.91E-02 -4.34E-01
Rectal cancer 2B92 Rectal colon tissue 1.16E-01 -2.21E-01 -1.36E+00
Renal cancer 2C90-2C91 Kidney 3.51E-04 -5.95E-01 -1.87E+00
Retinoblastoma 2D02.2 Uvea 9.61E-04 -2.06E-01 -2.60E+00
Rheumatoid arthritis FA20 Synovial tissue 4.57E-01 3.07E-03 1.32E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.83E-01 3.00E-02 3.05E-01
Schizophrenia 6A20 Prefrontal cortex 8.51E-01 -3.31E-02 -1.36E-01
Schizophrenia 6A20 Superior temporal cortex 5.85E-01 9.98E-03 8.85E-02
Scleroderma 4A42.Z Whole blood 3.47E-01 -2.68E-02 -2.08E-01
Seizure 8A60-8A6Z Whole blood 4.42E-01 3.36E-02 2.55E-01
Sensitive skin EK0Z Skin 9.17E-01 1.87E-02 1.19E-01
Sepsis with septic shock 1G41 Whole blood 9.01E-14 1.02E-01 6.84E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.76E-02 1.92E-01 7.96E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.85E-01 1.94E-01 1.05E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.47E-01 5.67E-02 1.61E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.37E-01 -1.94E-01 -1.15E+00
Skin cancer 2C30-2C3Z Skin 1.39E-05 2.63E-02 9.74E-02
Thrombocythemia 3B63 Whole blood 6.99E-02 3.52E-02 3.81E-01
Thrombocytopenia 3B64 Whole blood 6.58E-01 -1.72E-02 -1.14E-01
Thyroid cancer 2D10 Thyroid 3.18E-03 3.13E-02 1.47E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.22E-01 -1.66E-02 -1.00E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.87E-01 1.37E-01 9.06E-01
Type 2 diabetes 5A11 Liver tissue 5.91E-01 -1.04E-01 -5.29E-01
Ureter cancer 2C92 Urothelium 9.88E-01 -2.92E-03 -1.66E-02
Uterine cancer 2C78 Endometrium tissue 5.03E-01 -2.28E-02 -8.22E-02
Vitiligo ED63.0 Skin 6.51E-02 -7.93E-01 -1.58E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Zinc transporter 8 (SLC30A8) DTT Info
DTP DTT Type Literature-reported

References

1 Zinc transporter 8 (ZnT8) and cell function. Trends Endocrinol Metab. 2014 Aug;25(8):415-24.