Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTLHZFU)

• DTP Name: Glucose-6-phosphate translocase (SLC37A4)
• Gene Name: SLC37A4
• UniProt ID: O43826 (G6PT1_HUMAN)
• VARIDT ID: DTD0325
• Synonyms: G6PT; G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; Glucose-5-phosphate transporter; Glucose-6-phosphate exchanger SLC37A4; PRO0685; SLC37A4; Solute carrier family 37 member 4; TRG-19; TRG19; Transformation-related gene 19 protein
• DTP Family:
  Major Facilitator Superfamily (MFS)
  Organophosphate:Pi Antiporter (OPA) Family
• Tissue Specificity: Mostly expressed in liver and kidney.
• Sequence:
  MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAY
  AISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPP
  CGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVS
  FLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVK
  TCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR
  HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPN
  LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK
  MGRVSKKAE
• Function: This inorganic phosphate and glucose-6-phosphate antiporter in the endoplasmic reticulum that transports cytoplasmic glucose-6-phosphate into the lumen of the endoplasmic reticulum and translocates inorganic phosphate into the opposite direction.
• Endogenous Substrate(s): Phosphate; Glucose-6-phosphate
• TCDB ID: 2.A.1.4.5
• Gene ID: 2542
• KEGG Pathway: Carbohydrate digestion and absorption (hsa04973)
• Reactome Pathway:
  Gluconeogenesis (R-HSA-70263)
  Glycogen storage disease type Ib (SLC37A4) (R-HSA-3229133)

Molecular Interaction Atlas (MIA) of This DTP

1 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Glucose-6-Phosphate	DMKY1L4	N. A.	N. A.	Phase 1	[7]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	8.39E-10	-2.98E-01	-6.87E-01
Adrenocortical carcinoma	2D11.Z	Kidney	1.76E-02	1.61E-01	6.14E-01
Alopecia	ED70	Skin from scalp	3.12E-01	8.66E-02	3.68E-01
Alzheimer's disease	8A20	Entorhinal cortex	5.01E-02	-5.45E-02	-3.45E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	1.70E-01	8.42E-02	5.31E-01
Aortic stenosis	BB70	Calcified aortic valve	9.78E-01	3.50E-02	1.63E-01
Apnea	7A40	Hyperplastic tonsil	6.67E-02	-1.52E-01	-8.13E-01
Arthropathy	FA00-FA5Z	Peripheral blood	4.11E-02	-7.16E-02	-5.95E-01
Asthma	CA23	Nasal and bronchial airway	7.18E-03	6.44E-02	9.22E-02
Atopic dermatitis	EA80	Skin	7.05E-06	2.02E-01	1.14E+00
Autism	6A02	Whole blood	2.20E-01	-4.87E-02	-3.51E-01
Autoimmune uveitis	9A96	Peripheral monocyte	5.72E-01	-1.11E-01	-1.28E+00
Autosomal dominant monocytopenia	4B04	Whole blood	8.71E-01	4.55E-03	5.97E-02
Bacterial infection of gingival	1C1H	Gingival tissue	3.75E-03	6.27E-02	3.99E-01
Batten disease	5C56.1	Whole blood	7.84E-01	-7.19E-03	-5.49E-02
Behcet's disease	4A62	Peripheral blood	5.09E-01	-1.65E-02	-1.23E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	2.49E-01	-5.02E-02	-2.34E-01
Bladder cancer	2C94	Bladder tissue	2.07E-01	2.10E-01	7.59E-01
Breast cancer	2C60-2C6Z	Breast tissue	3.75E-30	1.92E-01	7.96E-01
Cardioembolic stroke	8B11.20	Whole blood	2.08E-04	-2.02E-01	-1.14E+00
Cervical cancer	2C77	Cervical tissue	2.89E-02	-1.54E-01	-7.71E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	5.13E-01	4.51E-03	3.84E-02
Chronic hepatitis C	1E51.1	Whole blood	9.49E-01	5.30E-03	4.34E-02
Chronic obstructive pulmonary disease	CA22	Lung tissue	5.65E-01	7.79E-02	4.42E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.36E-01	-4.07E-02	-1.96E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	2.72E-01	8.00E-02	5.11E-01
Colon cancer	2B90	Colon tissue	1.24E-21	-3.35E-01	-9.76E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	1.68E-01	2.93E-02	3.21E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	2.81E-01	2.49E-01	5.42E-01
Endometriosis	GA10	Endometrium tissue	2.18E-04	-2.25E-01	-4.86E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	2.08E-01	1.12E-01	1.24E+00
Familial hypercholesterolemia	5C80.00	Whole blood	1.18E-03	-1.47E-01	-6.98E-01
Gastric cancer	2B72	Gastric tissue	6.39E-01	-1.74E-01	-2.78E-01
Glioblastopma	2A00.00	Nervous tissue	8.58E-70	2.27E-01	1.15E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	4.88E-01	-8.86E-02	-1.99E-01
Head and neck cancer	2D42	Head and neck tissue	1.32E-15	-2.66E-01	-1.06E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	6.38E-01	3.26E-02	2.10E-01
Huntington's disease	8A01.10	Whole blood	8.14E-01	1.34E-02	7.08E-02
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	6.06E-01	-6.50E-03	-3.53E-02
Immunodeficiency	4A00-4A20	Peripheral blood	3.23E-01	-7.82E-02	-8.96E-01
Influenza	1.00E+30	Whole blood	2.86E-01	1.06E-01	7.73E-01
Interstitial cystitis	GC00.3	Bladder tissue	2.88E-02	-2.94E-01	-1.07E+00
Intracranial aneurysm	8B01.0	Intracranial artery	3.02E-01	1.76E-01	9.24E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	3.29E-02	-5.66E-01	-9.36E-01
Ischemic stroke	8B11	Peripheral blood	5.12E-01	1.53E-02	1.55E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	3.05E-05	-1.65E-01	-5.83E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	3.26E-01	-5.53E-02	-2.39E-01
Lateral sclerosis	8B60.4	Skin	4.32E-01	-1.08E-01	-5.29E-01
Liver cancer	2C12.0	Liver tissue	1.23E-12	-8.53E-01	-1.47E+00
Liver failure	DB99.7-DB99.8	Liver tissue	3.97E-07	-1.48E+00	-5.68E+00
Lung cancer	2C25	Lung tissue	2.11E-36	2.81E-01	1.13E+00
Lupus erythematosus	4A40	Whole blood	5.75E-04	-9.34E-02	-2.03E-01
Major depressive disorder	6A70-6A7Z	Whole blood	6.95E-01	-6.62E-02	-2.67E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	7.88E-01	2.45E-03	1.14E-02
Melanoma	2C30	Skin	2.30E-01	2.12E-01	3.55E-01
Multiple myeloma	2A83.1	Bone marrow	2.23E-06	5.75E-01	4.24E+00
Multiple myeloma	2A83.1	Peripheral blood	9.59E-01	-1.63E-01	-3.05E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	1.85E-01	3.47E-01	1.31E+00
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	8.29E-01	6.89E-02	2.53E-01
Myelofibrosis	2A20.2	Whole blood	3.25E-01	2.42E-02	1.93E-01
Myocardial infarction	BA41-BA50	Peripheral blood	6.50E-01	-2.34E-01	-5.09E-01
Myopathy	8C70.6	Muscle tissue	1.14E-03	-5.22E-01	-2.87E+00
Neonatal sepsis	KA60	Whole blood	3.24E-01	-4.80E-02	-2.63E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	7.41E-04	3.16E-01	1.36E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	9.39E-02	3.10E-01	5.61E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	9.47E-01	5.60E-02	3.33E-01
Olive pollen allergy	CA08.00	Peripheral blood	6.08E-01	1.51E-01	3.82E-01
Oral cancer	2B6E	Oral tissue	8.19E-04	-1.80E-01	-7.60E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	5.30E-01	-2.86E-02	-6.07E-02
Osteoporosis	FB83.1	Bone marrow	5.31E-02	1.76E-01	1.06E+00
Ovarian cancer	2C73	Ovarian tissue	2.16E-03	6.56E-01	1.78E+00
Pancreatic cancer	2C10	Pancreas	1.38E-01	-3.90E-01	-5.89E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	6.80E-01	3.45E-02	2.84E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	9.02E-01	-2.07E-02	-1.65E-01
Pituitary cancer	2D12	Pituitary tissue	1.10E-05	4.96E-01	2.33E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	6.34E-04	4.67E-01	1.97E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	1.37E-03	1.63E-01	9.40E-01
Polycythemia vera	2A20.4	Whole blood	5.48E-01	-2.81E-02	-1.96E-01
Pompe disease	5C51.3	Biceps muscle	1.47E-03	-6.95E-01	-1.29E+00
Preterm birth	KA21.4Z	Myometrium	2.69E-01	-1.18E-01	-1.28E+00
Prostate cancer	2C82	Prostate	2.94E-03	-9.47E-01	-1.02E+00
Psoriasis	EA90	Skin	1.25E-03	-4.60E-02	-1.41E-01
Rectal cancer	2B92	Rectal colon tissue	1.05E-04	-5.84E-01	-3.28E+00
Renal cancer	2C90-2C91	Kidney	6.13E-01	-2.66E-02	-3.81E-02
Retinoblastoma	2D02.2	Uvea	1.45E-01	-1.80E-01	-8.15E-01
Rheumatoid arthritis	FA20	Synovial tissue	8.62E-01	1.54E-01	3.20E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	7.32E-02	-2.63E-02	-2.29E-01
Schizophrenia	6A20	Prefrontal cortex	6.00E-01	8.52E-04	3.49E-03
Schizophrenia	6A20	Superior temporal cortex	7.84E-01	-1.44E-02	-1.88E-01
Scleroderma	4A42.Z	Whole blood	5.55E-02	-1.39E-01	-9.49E-01
Seizure	8A60-8A6Z	Whole blood	3.06E-01	6.69E-02	3.88E-01
Sensitive skin	EK0Z	Skin	9.08E-01	5.86E-02	5.79E-01
Sepsis with septic shock	1G41	Whole blood	7.06E-02	-2.34E-02	-1.54E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	4.71E-01	-2.88E-02	-1.94E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	9.16E-01	-6.12E-02	-3.62E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	6.27E-02	3.55E-01	1.58E+00
Sjogren's syndrome	4A43.2	Salivary gland tissue	1.68E-01	-2.44E-01	-1.35E+00
Skin cancer	2C30-2C3Z	Skin	1.87E-02	-7.50E-02	-2.00E-01
Thrombocythemia	3B63	Whole blood	2.43E-01	-2.97E-02	-2.14E-01
Thrombocytopenia	3B64	Whole blood	3.62E-01	8.69E-01	9.69E-01
Thyroid cancer	2D10	Thyroid	3.95E-01	-7.11E-02	-3.23E-01
Tibial muscular dystrophy	8C75	Muscle tissue	1.99E-07	-8.14E-01	-2.57E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	1.93E-01	-6.82E-02	-5.82E-01
Type 2 diabetes	5A11	Liver tissue	2.13E-01	-1.46E-01	-6.77E-01
Ureter cancer	2C92	Urothelium	9.95E-01	-5.46E-02	-5.55E-01
Uterine cancer	2C78	Endometrium tissue	6.54E-07	-3.13E-01	-5.15E-01
Vitiligo	ED63.0	Skin	8.03E-01	-1.18E-02	-9.09E-02

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Glucose-6-phosphate translocase (SLC37A4) DTT Info
• DTP DTT Type: Literature-reported

8 Investigative Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Chlorogenic acid	DM2Y3P4	Discovery agent	N.A.	Investigative	[1]
Kodaistatin A	DMAJKRX	Discovery agent	N.A.	Investigative	[2]
Kodaistatin C	DM72WQ3	Discovery agent	N.A.	Investigative	[2]
Mumbaistatin	DM6SYMH	Discovery agent	N.A.	Investigative	[3]
S 0957	DM9HA8G	Discovery agent	N.A.	Investigative	[4]
S 1743	DMA5GOX	Discovery agent	N.A.	Investigative	[4]
S 3025	DMZN0RW	Discovery agent	N.A.	Investigative	[5]
S-4048	DME5HIR	Discovery agent	N.A.	Investigative	[6]

References

• [1] Chlorogenic acid and synthetic chlorogenic acid derivatives: novel inhibitors of hepatic glucose-6-phosphate translocase. J Med Chem. 1997 Jan 17;40(2):137-45.
• [2] Kodaistatins, novel inhibitors of glucose-6-phosphate translocase T1 from Aspergillus terreus thom DSM 11247. Isolation and structural elucidation. J Antibiot (Tokyo). 2000 Jul;53(7):677-86.
• [3] Studies toward the total synthesis of mumbaistatin, a highly potent glucose-6-phosphate translocase inhibitor. Synthesis of a mumbaistatin analogue. J Org Chem. 2002 Dec 27;67(26):9248-56.
• [4] Identification of protein components of the microsomal glucose 6-phosphate transporter by photoaffinity labelling. Biochem J. 1999 May 1;339 ( Pt 3):629-38.
• [5] Prolonged blood glucose reduction in mrp-2 deficient rats (GY/TR(-)) by the glucose-6-phosphate translocase inhibitor S 3025. Biochim Biophys Acta. 2002 Jan 15;1569(1-3):105-10.
• [6] Glucose release from GLUT2-null hepatocytes: characterization of a major and a minor pathway. Am J Physiol Endocrinol Metab. 2002 Apr;282(4):E794-801.
• [7] A novel mutation (A148V) in the glucose 6-phosphate translocase (SLC37A4) gene in a Korean patient with glycogen storage disease type 1b. J Korean Med Sci. 2005 Jun;20(3):499-501.