Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT1KPBZ)

• DTT Name: Glucose-6-phosphate translocase (SLC37A4)
• Synonyms: Transformation-related gene 19 protein; TRG19; TRG-19; Solute carrier family 37 member 4; PRO0685; Glucose-6-phosphate exchanger SLC37A4; Glucose-5-phosphate transporter; Glucose 5-phosphate transporter; G6PT1
• Gene Name: SLC37A4
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Major facilitator
• UniProt ID: G6PT1_HUMAN
• TTD ID: T47306
• Sequence:
  MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAY
  AISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPP
  CGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVS
  FLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVK
  TCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR
  HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPN
  LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK
  MGRVSKKAE
• Function: Transports cytoplasmic glucose-6-phosphate into the lumen of the endoplasmic reticulum and translocates inorganic phosphate into the opposite direction. Forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels. Inorganic phosphate and glucose-6-phosphate antiporter of the endoplasmic reticulum.
• KEGG Pathway: Carbohydrate digestion and absorption (hsa04973)
• Reactome Pathway: Glucose transport (R-HSA-70153)

Molecular Interaction Atlas (MIA) of This DTT

8 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Chlorogenic acid	DM2Y3P4	Discovery agent	N.A.	Investigative	[2]
Kodaistatin A	DMAJKRX	Discovery agent	N.A.	Investigative	[3]
Kodaistatin C	DM72WQ3	Discovery agent	N.A.	Investigative	[3]
Mumbaistatin	DM6SYMH	Discovery agent	N.A.	Investigative	[4]
S 0957	DM9HA8G	Discovery agent	N.A.	Investigative	[1]
S 1743	DMA5GOX	Discovery agent	N.A.	Investigative	[1]
S 3025	DMZN0RW	Discovery agent	N.A.	Investigative	[5]
S-4048	DME5HIR	Discovery agent	N.A.	Investigative	[6]

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Glucose-6-phosphate translocase (SLC37A4) DTP Info
• Gene Name: SLC37A4

1 Clinical Trial Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Glucose-6-Phosphate	DMKY1L4	N. A.	N. A.	Phase 1	[7]

References

• [1] Identification of protein components of the microsomal glucose 6-phosphate transporter by photoaffinity labelling. Biochem J. 1999 May 1;339 ( Pt 3):629-38.
• [2] Chlorogenic acid and synthetic chlorogenic acid derivatives: novel inhibitors of hepatic glucose-6-phosphate translocase. J Med Chem. 1997 Jan 17;40(2):137-45.
• [3] Kodaistatins, novel inhibitors of glucose-6-phosphate translocase T1 from Aspergillus terreus thom DSM 11247. Isolation and structural elucidation. J Antibiot (Tokyo). 2000 Jul;53(7):677-86.
• [4] Studies toward the total synthesis of mumbaistatin, a highly potent glucose-6-phosphate translocase inhibitor. Synthesis of a mumbaistatin analogue. J Org Chem. 2002 Dec 27;67(26):9248-56.
• [5] Prolonged blood glucose reduction in mrp-2 deficient rats (GY/TR(-)) by the glucose-6-phosphate translocase inhibitor S 3025. Biochim Biophys Acta. 2002 Jan 15;1569(1-3):105-10.
• [6] Glucose release from GLUT2-null hepatocytes: characterization of a major and a minor pathway. Am J Physiol Endocrinol Metab. 2002 Apr;282(4):E794-801.
• [7] A novel mutation (A148V) in the glucose 6-phosphate translocase (SLC37A4) gene in a Korean patient with glycogen storage disease type 1b. J Korean Med Sci. 2005 Jun;20(3):499-501.