Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTN7X5J)

DTP Name Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25)
Gene Name SLC25A25
UniProt ID
Q6KCM7 (SCMC2_HUMAN)
VARIDT ID
DTD0186
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
APC3; KIAA1896; MCSC; MCSC3; Mitochondrial ATP-Mg/Pi carrier protein 3; Mitochondrial Ca(2+)-dependent solute carrier protein 3; PCSCL; SCAMC-2; SCAMC2; SLC25A25; Small calcium-binding mitochondrial carrier protein 2; Solute carrier family 25 member 25
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Present in various cell lines (at proteinlevel). Widely expressed. Expressed in fetal and adult liver,skeletal muscle, testis, ovary, hippocampus and caudate nucleus.Isoform 1 is present in all tissues tested. Isoform 2 expressionis restricted to kidney and lung.
Sequence
MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD
KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE
KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE
RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGAR
SLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP
MEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETL
KNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS
SLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Function
This calcium-dependent mitochondrial transporter shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Endogenous Substrate(s) Mg 2+; ATP
TCDB ID
2.A.29.23.1
Gene ID
114789

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phosphate DMUXQG7 Constipation DD91.1 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.51E-11 1.30E-01 4.82E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.96E-02 -5.01E-01 -7.49E-01
Alopecia ED70 Skin from scalp 9.70E-04 2.68E-01 7.07E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.19E-04 -9.05E-02 -2.93E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.03E-01 -4.57E-02 -4.18E-01
Aortic stenosis BB70 Calcified aortic valve 3.31E-01 2.90E-01 8.69E-01
Apnea 7A40 Hyperplastic tonsil 3.02E-01 2.02E-01 2.04E-01
Arthropathy FA00-FA5Z Peripheral blood 2.28E-01 -8.35E-02 -5.01E-01
Asthma CA23 Nasal and bronchial airway 3.06E-06 1.04E+00 1.13E+00
Atopic dermatitis EA80 Skin 1.23E-01 7.95E-02 4.26E-01
Autism 6A02 Whole blood 3.66E-01 -2.00E-01 -6.91E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.99E-01 -6.80E-02 -3.10E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.27E-01 2.86E-02 2.48E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.43E-01 5.47E-02 1.04E-01
Batten disease 5C56.1 Whole blood 7.10E-01 -6.67E-02 -4.52E-01
Behcet's disease 4A62 Peripheral blood 9.90E-01 -3.70E-02 -1.93E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.79E-01 -1.07E-02 -5.18E-02
Bladder cancer 2C94 Bladder tissue 9.79E-02 2.15E-01 1.09E+00
Breast cancer 2C60-2C6Z Breast tissue 2.99E-11 -2.22E-01 -3.31E-01
Cardioembolic stroke 8B11.20 Whole blood 4.21E-11 -5.30E-01 -2.47E+00
Cervical cancer 2C77 Cervical tissue 5.37E-01 5.30E-02 1.23E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.00E-01 -7.12E-02 -2.74E-01
Chronic hepatitis C 1E51.1 Whole blood 1.49E-01 -1.02E-01 -5.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.87E-01 2.36E-01 3.48E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.72E-01 -5.85E-02 -1.01E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.40E-03 -1.60E+00 -2.00E+00
Colon cancer 2B90 Colon tissue 1.64E-02 1.24E-01 2.95E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.39E-01 -2.50E-01 -9.47E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.38E-01 -3.91E-02 -1.53E-01
Endometriosis GA10 Endometrium tissue 4.70E-01 -3.37E-02 -1.25E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.87E-03 2.13E-01 1.05E+00
Familial hypercholesterolemia 5C80.00 Whole blood 7.51E-05 2.57E-01 1.30E+00
Gastric cancer 2B72 Gastric tissue 2.66E-01 8.08E-01 1.29E+00
Glioblastopma 2A00.00 Nervous tissue 5.00E-11 -2.39E-01 -5.46E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.30E-01 -2.56E-02 -3.69E-02
Head and neck cancer 2D42 Head and neck tissue 2.79E-02 -1.51E-01 -3.17E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.69E-02 -2.99E-01 -8.47E-01
Huntington's disease 8A01.10 Whole blood 2.39E-01 -4.72E-02 -2.39E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.03E-03 -9.73E-01 -2.46E+00
Immunodeficiency 4A00-4A20 Peripheral blood 6.73E-01 -4.57E-02 -3.83E-01
Influenza 1.00E+30 Whole blood 4.28E-04 -6.95E-01 -4.88E+00
Interstitial cystitis GC00.3 Bladder tissue 1.11E-01 4.17E-02 5.77E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.41E-02 -7.71E-01 -7.49E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.43E-01 -4.24E-02 -1.58E-01
Ischemic stroke 8B11 Peripheral blood 3.91E-02 1.64E-01 6.93E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.10E-01 1.02E-01 3.89E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.07E-01 4.58E-02 7.42E-02
Lateral sclerosis 8B60.4 Skin 4.20E-01 -1.11E-01 -1.43E+00
Liver cancer 2C12.0 Liver tissue 1.02E-05 -8.47E-01 -8.54E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.11E-01 -2.65E-01 -8.05E-01
Lung cancer 2C25 Lung tissue 5.33E-36 -8.88E-01 -1.25E+00
Lupus erythematosus 4A40 Whole blood 3.19E-01 7.06E-02 1.31E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.61E-01 4.26E-02 1.86E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.66E-01 1.26E-02 5.89E-02
Melanoma 2C30 Skin 3.13E-01 -1.07E-01 -1.41E-01
Multiple myeloma 2A83.1 Bone marrow 6.92E-08 4.92E-01 5.64E+00
Multiple myeloma 2A83.1 Peripheral blood 4.10E-01 -1.85E-01 -4.41E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.18E-01 -4.70E-02 -1.62E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.11E-01 2.86E-03 1.13E-02
Myelofibrosis 2A20.2 Whole blood 5.00E-01 -2.87E-02 -2.79E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.09E-02 -7.30E-01 -7.80E-01
Myopathy 8C70.6 Muscle tissue 1.63E-03 -3.97E-01 -1.22E+00
Neonatal sepsis KA60 Whole blood 3.11E-06 -2.26E-01 -9.54E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.34E-02 2.13E-01 6.53E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.50E-02 -7.01E-01 -9.74E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.25E-01 1.81E-01 4.40E-01
Olive pollen allergy CA08.00 Peripheral blood 6.83E-01 2.41E-01 5.22E-01
Oral cancer 2B6E Oral tissue 2.17E-01 -1.55E-01 -2.27E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.31E-01 -2.68E-01 -5.62E-01
Osteoporosis FB83.1 Bone marrow 3.33E-01 3.63E-02 7.61E-02
Ovarian cancer 2C73 Ovarian tissue 7.17E-03 -7.95E-01 -1.18E+00
Pancreatic cancer 2C10 Pancreas 4.13E-02 -4.16E-01 -6.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.53E-01 -2.42E-01 -5.61E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.36E-01 4.85E-02 2.99E-01
Pituitary cancer 2D12 Pituitary tissue 2.88E-02 -6.28E-01 -9.62E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.53E-03 -8.08E-01 -1.35E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.20E-01 -1.75E-02 -6.26E-02
Polycythemia vera 2A20.4 Whole blood 2.72E-01 -3.30E-02 -2.24E-01
Pompe disease 5C51.3 Biceps muscle 3.16E-01 -1.39E-01 -3.63E-01
Preterm birth KA21.4Z Myometrium 6.71E-01 -1.95E-01 -5.49E-01
Prostate cancer 2C82 Prostate 3.61E-03 3.78E-01 4.50E-01
Psoriasis EA90 Skin 1.49E-09 6.00E-01 1.04E+00
Rectal cancer 2B92 Rectal colon tissue 1.19E-01 1.69E-01 6.74E-01
Renal cancer 2C90-2C91 Kidney 9.92E-03 -6.19E-01 -1.16E+00
Retinoblastoma 2D02.2 Uvea 2.19E-03 -3.34E-01 -1.35E+00
Rheumatoid arthritis FA20 Synovial tissue 6.00E-02 -3.94E-01 -1.10E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.59E-02 -6.55E-02 -4.81E-01
Schizophrenia 6A20 Prefrontal cortex 3.76E-02 -3.48E-01 -7.24E-01
Schizophrenia 6A20 Superior temporal cortex 6.13E-01 -1.13E-01 -7.54E-01
Scleroderma 4A42.Z Whole blood 3.40E-01 -3.73E-02 -1.49E-01
Seizure 8A60-8A6Z Whole blood 5.43E-01 -8.85E-02 -4.71E-01
Sensitive skin EK0Z Skin 5.66E-02 3.45E-01 2.66E+00
Sepsis with septic shock 1G41 Whole blood 8.74E-26 -2.63E-01 -1.17E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.20E-02 -1.99E-01 -1.10E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.81E-01 -3.23E-02 -1.05E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.33E-02 3.74E-01 1.62E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.58E-01 2.02E-01 1.39E+00
Skin cancer 2C30-2C3Z Skin 4.54E-06 2.42E-01 4.60E-01
Thrombocythemia 3B63 Whole blood 7.60E-01 8.17E-03 7.00E-02
Thrombocytopenia 3B64 Whole blood 8.43E-01 -6.21E-02 -2.42E-01
Thyroid cancer 2D10 Thyroid 1.08E-25 -6.80E-01 -1.28E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.51E-02 -4.92E-01 -7.24E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.69E-02 -2.35E-01 -1.88E+00
Type 2 diabetes 5A11 Liver tissue 2.57E-01 -3.04E-01 -8.45E-01
Ureter cancer 2C92 Urothelium 1.17E-01 1.04E-01 5.08E-01
Uterine cancer 2C78 Endometrium tissue 3.49E-14 -5.53E-01 -9.15E-01
Vitiligo ED63.0 Skin 3.58E-02 3.83E-01 1.27E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Ketogenic diet induces expression of the muscle circadian gene Slc25a25 via neural pathway that might be involved in muscle thermogenesis. Sci Rep. 2017 Jun 6;7(1):2885.