Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTW40Z7)

DTP Name Electroneutral sodium bicarbonate exchanger 1 (SLC4A8)
Gene Name SLC4A8
UniProt ID
Q2Y0W8 (S4A8_HUMAN)
VARIDT ID
DTD0388
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Electroneutral Na(+)-driven Cl-HCO3 exchanger; KIAA0739; NDCBE; NDCBE1; SLC4A8; Solute carrier family 4 member 8; k-NBC3
DTP Family Anion Exchanger (AE) Family ;
Sequence
MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQS
HRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGTEEDEEHVPHELFTEL
DEICMKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCLINGTVLL
DMHANSIEEISDLILDQQELSSDLNDSMRVKVREALLKKHHHQNEKKRNNLIPIVRSFAE
VGKKQSDPHLMDKHGQTVSPQSVPTTNLEVKNGVNCEHSPVDLSKVDLHFMKKIPTGAEA
SNVLVGEVDILDRPIVAFVRLSPAVLLSGLTEVPIPTRFLFILLGPVGKGQQYHEIGRSM
ATIMTDEIFHDVAYKAKERDDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKRK
MPGVPNGNVCHIEQEPHGGHSGPELQRTGRLFGGLVLDIKRKAPWYWSDYRDALSLQCLA
SFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQALTILGSTGP
VLVFEKILFKFCKDYALSYLSLRACIGLWTAFLCIVLVATDASSLVCYITRFTEEAFASL
ICIIFIYEAIEKLIHLAETYPIHMHSQLDHLSLYYCRCTLPENPNNHTLQYWKDHNIVTA
EVHWANLTVSECQEMHGEFMGSACGHHGPYTPDVLFWSCILFFTTFILSSTLKTFKTSRY
FPTRVRSMVSDFAVFLTIFTMVIIDFLIGVPSPKLQVPSVFKPTRDDRGWIINPIGPNPW
WTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAIMLGVCSIMGL
PWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTAILK
FIPMPVLYGVFLYMGVSSLQGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTLIQL
TCLVLLWVIKASPAAIVFPMMVLALVFVRKVMDLCFSKRELSWLDDLMPESKKKKLDDAK
KKAKEEEEAEKMLEIGGDKFPLESRKLLSSPGKNISCRCDPSEINISDEMPKTTVWKALS
MNSGNAKEKSLFN
Function
This transporter regulates pH in neurons and mediates electroneutral sodium- and carbonate-dependent chloride-HCO3(-) exchange with a Na(+):HCO3(-) stoichiometry of 2:1. May be involved in cell pH regulation by transporting HCO3(-) from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3(-) into the cells. Also mediates lithium-dependent HCO3(-) cotransport. May be regulated by osmolarity.
Endogenous Substrate(s) Cl-; Na+
TCDB ID
2.A.31.2.4
Gene ID
9498
Reactome Pathway
Bicarbonate transporters (R-HSA-425381 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sodium bicarbonate DMMU6BJ Metabolic acidosis 5C73 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.21E-04 4.47E-02 3.41E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.13E-05 6.20E-01 1.51E+00
Alopecia ED70 Skin from scalp 1.65E-01 7.30E-02 3.10E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.04E-06 -3.71E-01 -6.56E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.27E-01 1.90E-01 3.10E-01
Aortic stenosis BB70 Calcified aortic valve 8.20E-01 3.44E-02 5.14E-02
Apnea 7A40 Hyperplastic tonsil 5.93E-01 1.12E-01 8.28E-01
Arthropathy FA00-FA5Z Peripheral blood 9.21E-01 3.95E-02 2.64E-01
Asthma CA23 Nasal and bronchial airway 6.59E-04 -2.16E-01 -3.05E-01
Atopic dermatitis EA80 Skin 1.22E-03 1.27E-01 8.82E-01
Autism 6A02 Whole blood 3.35E-01 -3.05E-02 -1.86E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.98E-02 3.49E-01 1.83E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.93E-01 -8.02E-02 -4.83E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.04E-02 7.40E-02 2.57E-01
Batten disease 5C56.1 Whole blood 3.66E-01 8.46E-02 7.94E-01
Behcet's disease 4A62 Peripheral blood 6.78E-01 -5.32E-05 -4.60E-04
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.67E-01 6.81E-02 2.89E-01
Bladder cancer 2C94 Bladder tissue 3.64E-04 4.55E-01 2.07E+00
Breast cancer 2C60-2C6Z Breast tissue 8.54E-106 6.03E-01 1.86E+00
Cardioembolic stroke 8B11.20 Whole blood 1.15E-01 -7.65E-02 -2.37E-01
Cervical cancer 2C77 Cervical tissue 4.74E-02 -1.04E-01 -4.20E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.28E-01 -4.96E-02 -1.49E-01
Chronic hepatitis C 1E51.1 Whole blood 9.53E-01 8.41E-02 3.38E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.49E-02 1.76E-01 8.33E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.53E-05 2.51E-01 4.87E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.69E-01 -6.16E-02 -1.70E-01
Colon cancer 2B90 Colon tissue 3.11E-24 1.45E-01 7.73E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.56E-01 -2.14E-01 -7.63E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.96E-01 -7.86E-02 -2.69E-01
Endometriosis GA10 Endometrium tissue 4.16E-01 1.27E-01 4.96E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.12E-01 -7.00E-02 -2.66E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.57E-01 3.14E-02 1.82E-01
Gastric cancer 2B72 Gastric tissue 3.81E-01 1.82E-02 1.27E-01
Glioblastopma 2A00.00 Nervous tissue 2.07E-38 -5.76E-01 -8.88E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.98E-01 -2.24E-01 -2.78E-01
Head and neck cancer 2D42 Head and neck tissue 1.23E-12 -3.28E-01 -2.77E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.77E-01 7.45E-02 2.59E-01
Huntington's disease 8A01.10 Whole blood 3.53E-01 1.12E-02 7.98E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.43E-04 6.69E-01 3.07E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.58E-01 3.22E-02 3.54E-01
Influenza 1.00E+30 Whole blood 4.82E-01 -6.91E-02 -1.16E-01
Interstitial cystitis GC00.3 Bladder tissue 2.53E-02 1.48E-01 2.36E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.22E-03 2.94E-01 2.03E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.58E-02 7.81E-02 2.10E-01
Ischemic stroke 8B11 Peripheral blood 7.95E-01 5.88E-02 3.84E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.18E-01 1.43E-02 3.46E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.23E-01 -1.22E-03 -1.90E-03
Lateral sclerosis 8B60.4 Skin 1.12E-02 3.60E-01 1.96E+00
Liver cancer 2C12.0 Liver tissue 1.96E-01 -8.57E-02 -4.40E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.24E-01 1.53E-01 8.07E-01
Lung cancer 2C25 Lung tissue 2.83E-02 -4.99E-02 -1.74E-01
Lupus erythematosus 4A40 Whole blood 6.91E-01 8.17E-03 2.69E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.51E-01 -3.79E-02 -1.07E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.89E-01 1.13E-02 4.66E-02
Melanoma 2C30 Skin 4.75E-01 2.22E-01 3.07E-01
Multiple myeloma 2A83.1 Bone marrow 3.27E-06 -4.71E-01 -4.49E+00
Multiple myeloma 2A83.1 Peripheral blood 1.44E-01 8.83E-02 2.67E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.40E-03 3.39E-01 3.70E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.11E-01 3.26E-02 1.28E-01
Myelofibrosis 2A20.2 Whole blood 9.26E-02 2.31E-02 1.76E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.94E-01 1.12E-01 1.60E-01
Myopathy 8C70.6 Muscle tissue 4.16E-01 -9.11E-02 -5.56E-01
Neonatal sepsis KA60 Whole blood 3.43E-01 -2.82E-02 -1.50E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.05E-03 -3.77E-01 -1.14E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.34E-01 6.26E-03 5.10E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.93E-01 7.16E-03 8.17E-02
Olive pollen allergy CA08.00 Peripheral blood 8.18E-01 2.42E-01 1.94E-01
Oral cancer 2B6E Oral tissue 9.82E-01 -1.37E-01 -4.13E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.15E-01 -1.37E-02 -4.80E-02
Osteoporosis FB83.1 Bone marrow 4.42E-01 -1.00E-01 -2.01E-01
Ovarian cancer 2C73 Ovarian tissue 1.00E-01 -3.40E-01 -4.11E-01
Pancreatic cancer 2C10 Pancreas 2.46E-01 -2.62E-01 -5.12E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.16E-02 -6.53E-01 -1.43E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.04E-01 -7.96E-02 -5.70E-01
Pituitary cancer 2D12 Pituitary tissue 1.73E-01 -2.49E-01 -6.96E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.35E-01 2.98E-01 7.06E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.42E-01 -3.63E-03 -2.50E-02
Polycythemia vera 2A20.4 Whole blood 5.68E-04 1.08E-01 8.17E-01
Pompe disease 5C51.3 Biceps muscle 2.67E-02 -1.64E-01 -8.47E-01
Preterm birth KA21.4Z Myometrium 9.49E-02 -1.27E-01 -7.64E-01
Prostate cancer 2C82 Prostate 6.47E-04 -5.45E-01 -1.33E+00
Psoriasis EA90 Skin 2.33E-03 -1.31E-01 -4.51E-01
Rectal cancer 2B92 Rectal colon tissue 1.63E-04 2.04E-01 2.04E+00
Renal cancer 2C90-2C91 Kidney 1.68E-03 -5.54E-01 -1.46E+00
Retinoblastoma 2D02.2 Uvea 4.21E-06 -1.34E+00 -4.91E+00
Rheumatoid arthritis FA20 Synovial tissue 6.51E-01 4.55E-02 1.99E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.61E-01 3.14E-02 7.08E-02
Schizophrenia 6A20 Prefrontal cortex 2.74E-02 -2.72E-01 -2.67E-01
Schizophrenia 6A20 Superior temporal cortex 1.38E-01 -2.45E-01 -6.74E-01
Scleroderma 4A42.Z Whole blood 4.69E-04 1.94E-01 1.90E+00
Seizure 8A60-8A6Z Whole blood 7.24E-01 -4.57E-02 -3.52E-01
Sensitive skin EK0Z Skin 7.22E-01 -1.01E-01 -4.63E-01
Sepsis with septic shock 1G41 Whole blood 4.08E-03 -7.05E-02 -3.34E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.88E-02 2.24E-01 1.30E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.32E-01 -1.67E-02 -1.04E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.68E-01 -2.48E-02 -1.97E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.52E-01 -3.02E-01 -9.79E-01
Skin cancer 2C30-2C3Z Skin 2.67E-12 1.79E-01 5.81E-01
Thrombocythemia 3B63 Whole blood 3.81E-03 1.01E-01 8.28E-01
Thrombocytopenia 3B64 Whole blood 7.91E-01 -4.55E-02 -1.12E-01
Thyroid cancer 2D10 Thyroid 1.69E-04 2.28E-02 1.22E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.76E-01 2.20E-02 1.26E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.56E-03 -6.83E-01 -2.52E+00
Type 2 diabetes 5A11 Liver tissue 8.70E-01 -1.79E-02 -8.20E-02
Ureter cancer 2C92 Urothelium 6.20E-01 9.59E-02 2.97E-01
Uterine cancer 2C78 Endometrium tissue 2.55E-01 6.35E-02 1.95E-01
Vitiligo ED63.0 Skin 1.71E-01 8.76E-02 5.52E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The sodium bicarbonate cotransporter: structure, function, and regulation. Semin Nephrol. 2006 Sep;26(5):352-60.