Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT48I1Y)

• DTT Name: Placenta growth factor (PlGF)
• Synonyms: SHGC-10760; PlGF-2; PLGF; PGFL; D12S1900
• Gene Name: PGF
• DTT Type: Successful target; [1]
• BioChemical Class: Growth factor
• UniProt ID: PLGF_HUMAN
• TTD ID: T70792
• Sequence:
  MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
  VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
  TFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWP
  SSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
• Function: It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration.
• KEGG Pathway:
  Ras signaling pathway (hsa04014)
  Rap1 signaling pathway (hsa04015)
  PI3K-Akt signaling pathway (hsa04151)
  Focal adhesion (hsa04510)
  Pathways in cancer (hsa05200)
• Reactome Pathway:
  VEGF binds to VEGFR leading to receptor dimerization (R-HSA-195399)
  VEGF ligand-receptor interactions (R-HSA-194313)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aflibercept	DMT3D5I	Central retinal vein occlusion with macular edema		Approved	[1]

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RO-5323441	DMUB3OY	Solid tumour/cancer	2A00-2F9Z	Phase 2	[2]
TB-403	DMDPBMH	Glioblastoma of brain	2A00.00	Phase 2	[3]
R7334	DMVA186	Macular degeneration	9B78.3	Phase 1	[4]
SFLT-01	DMD2GKF	Macular degeneration	9B78.3	Phase 1	[5]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-Methyl-2,4-Pentanediol	DMD45CU	Discovery agent	N.A.	Investigative	[6]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rectal cancer	2C82	Rectal colon tissue	1.44E-03	-0.32	-1.84

References

• [1] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [2] RO5323441, a humanized monoclonal antibody against the placenta growth factor, blocks PlGF-induced VEGFR-1 phosphorylation in vitro and tumor growth in vivo. Cancer Research. 01/2011.
• [3] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [4] Clinical pipeline report, company report or official report of Roche (2009).
• [5] sFLT01: a novel fusion protein with antiangiogenic activity. Mol Cancer Ther. 2011 Mar;10(3):404-15.
• [6] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.