Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5Z9WY)

• DTT Name: Complement decay-accelerating factor (CD55)
• Synonyms: DAF; Complement decayaccelerating factor; CR
• Gene Name: CD55
• DTT Type: Clinical trial target; [1]
• UniProt ID: DAF_HUMAN
• TTD ID: T78114
• Sequence:
  MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
  ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
  VGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
  LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
  DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
  TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS
  GHTCFTLTGLLGTLVTMGLLT
• Function: Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage. This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation.
• KEGG Pathway:
  Complement and coagulation cascades (hsa04610)
  Hematopoietic cell lineage (hsa04640)
  Viral myocarditis (hsa05416)
• Reactome Pathway:
  Regulation of Complement cascade (R-HSA-977606)
  Class B/2 (Secretin family receptors) (R-HSA-373080)

Molecular Interaction Atlas (MIA) of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Coxsackievirus A21	DM2K5VP	Glioblastoma multiforme	2A00.0	Phase 2	[1]
Onyvax-105	DMGIN7J	Prostate cancer	2C82.0	Phase 1/2	[2]
PAT-SC1	DMZKFJO	Gastric adenocarcinoma	2B72	Phase 1/2	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Gastric cancer	2C82	Gastric tissue	2.44E-02	2.16	3.38
Rectal cancer	2C82	Rectal colon tissue	2.29E-02	0.74	1.15
Glioma	2C82	Brainstem tissue	3.50E-01	-1.01	-1.02
Glioma	2C82	White matter	1.38E-02	-0.62	-0.87

References

• [1] Oncolytic Coxsackievirus A21 as a novel therapy for multiple myeloma. Br J Haematol. 2007 Apr;137(2):133-41.
• [2] Technology evaluation: Onyvax-105, Onyvax. Curr Opin Mol Ther. 2003 Dec;5(6):668-72.
• [3] Ten-year follow-up of a prospective trial for the targeted therapy of gastric cancer with the human monoclonal antibody PAT-SC1. Oncol Rep. 2014 Mar;31(3):1059-66.