Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5ZKDI)

• DTT Name: Histone deacetylase 6 (HDAC6)
• Synonyms: KIAA0901; JM21; HD6
• Gene Name: HDAC6
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Carbon-nitrogen hydrolase
• UniProt ID: HDAC6_HUMAN
• TTD ID: T22274
• EC Number: EC 3.5.1.98
• Sequence:
  MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
  QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
  QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
  YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
  KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
  QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
  AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
  QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
  TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
  SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
  GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
  EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
  RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
  GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
  DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
  AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
  ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
  TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
  AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
  ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
  IAHQNKFGEDMPHPH
• Function: Gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).
• KEGG Pathway:
  Alcoholism (hsa05034)
  Viral carcinogenesis (hsa05203)
• Reactome Pathway:
  Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606)
  Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)
  Assembly of the primary cilium (R-HSA-5617833)
  NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947)
• BioCyc Pathway: MetaCyc:HS01799-MON

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Citarinostat	DMQLODU	Multiple myeloma	2A83	Phase 1	[2]
KA2507	DMW0H9Y	Solid tumour/cancer	2A00-2F9Z	Phase 1	[2]

77 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Diaryl amine derivative 2	DMRBYAV	N. A.	N. A.	Patented	[3]
Diaryl amine derivative 3	DMLBN1T	N. A.	N. A.	Patented	[3]
Diaryl amine derivative 4	DMZL6AX	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32a	DMGZ61E	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32b	DMT2B5A	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32c	DMGA3XL	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32d	DMW21U4	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32e	DM8NHQS	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32f	DMEIZ6Y	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32g	DMTKLEP	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32h	DME1WHT	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32i	DMN3ZEF	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32j	DMSGWTX	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32k	DMHSJ65	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32l	DMSP5IA	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32m	DMADMWB	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32n	DMJO3RW	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32o	DMV9BQN	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32p	DM4ZO21	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32q	DMEASZY	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32r	DMLTKMS	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32s	DMS103B	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32t	DM2JF0T	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32u	DM805ZN	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32v	DMHV3ES	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32x	DML79XQ	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32y	DMLR03U	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-32z	DMEPWGH	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33a	DM7GH4Y	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33b	DMIJQZV	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33c	DM51JP6	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33d	DMW38MK	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33e	DMGTSXL	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33f	DMA360M	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33g	DM18DY6	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33h	DM1DN6V	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33i	DM16E95	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33j	DMNTRIZ	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33k	DMF2ZNT	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33l	DMPJSB2	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33m	DMXSPT9	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33o	DM6DJZ7	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-33p	DMI8ZBK	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-34a	DMXQE7C	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-34b	DM6X2CO	N. A.	N. A.	Patented	[3]
PMID28092474-Compound-34c	DMMI7DY	N. A.	N. A.	Patented	[3]
PMID29671355-Compound-11	DMNKABH	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-13	DMALXYR	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-14	DM8UMQH	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-15	DMAEPD4	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-16	DM2C6ZF	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-18	DMUY53P	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-19	DM9LMNB	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-21	DMPJN0M	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-22	DMRGV83	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-23	DMUBOEX	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-24	DMCIGJ1	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-25	DMPV0KZ	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-26	DM5K6MG	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-27	DMP7S9E	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-28	DMLXSHW	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-31	DM3H78D	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-38a	DMYATB5	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-38b	DMYXE4J	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-39	DM6EJ93	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-43	DMVPMWJ	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-44	DM80A3V	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-56	DM0VBMI	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-61	DMXH1G3	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-62	DMWRS34	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-65a	DMY3Q58	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-67	DM1RPL4	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-73	DMCNF36	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-74	DM49YTU	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-8	DM7YQJK	N. A.	N. A.	Patented	[4]
PMID29671355-Compound-9	DMXL96M	N. A.	N. A.	Patented	[4]
Sulfonamide derivative 16	DMTFNGM	N. A.	N. A.	Patented	[5]

92 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one	DM5LSY9	Discovery agent	N.A.	Investigative	[6]
(S)-2-Amino-N-cyclopentyl-7-mercaptoheptanamide	DMDWFHV	Discovery agent	N.A.	Investigative	[7]
2-(methylsulfonylthio)ethyl 2-propylpentanoate	DMM52D3	Discovery agent	N.A.	Investigative	[8]
4-Benzoylamino-N-hydroxy-benzamide	DMYBPFS	Discovery agent	N.A.	Investigative	[9]
4-Butyrylamino-N-hydroxy-benzamide	DMRY6B4	Discovery agent	N.A.	Investigative	[10]
4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide	DM5AVG3	Discovery agent	N.A.	Investigative	[11]
4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide	DM0M8G5	Discovery agent	N.A.	Investigative	[12]
4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide	DMULOHZ	Discovery agent	N.A.	Investigative	[13]
4-Phenylbutyrohydroxamic acid	DMCZKN7	Discovery agent	N.A.	Investigative	[14]
5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide	DM6CRVS	Discovery agent	N.A.	Investigative	[15]
5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione	DM7KQXL	Discovery agent	N.A.	Investigative	[8]
5-Mercapto-pentanoic acid phenylamide	DMET3OJ	Discovery agent	N.A.	Investigative	[12]
6-(2-Bromo-acetylamino)-hexanoic acid phenylamide	DM9LKXD	Discovery agent	N.A.	Investigative	[12]
6-(9H-carbazol-9-yl)-N-hydroxyhexanamide	DMVMDJ3	Discovery agent	N.A.	Investigative	[16]
6-benzenesulfinylhexanoic acid hydroxamide	DM2I95Z	Discovery agent	N.A.	Investigative	[17]
6-benzenesulfonylhexanoic acid hydroxamide	DMY9IK8	Discovery agent	N.A.	Investigative	[17]
6-Mercapto-hexanoic acid phenylamide	DMD2FW9	Discovery agent	N.A.	Investigative	[12]
6-Phenoxy-hexane-1-thiol	DMVYIN2	Discovery agent	N.A.	Investigative	[12]
6-phenylsulfanylhexanoic acid hydroxamide	DM3OLM6	Discovery agent	N.A.	Investigative	[17]
7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one	DMLCGSY	Discovery agent	N.A.	Investigative	[6]
7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one	DM28GZ7	Discovery agent	N.A.	Investigative	[11]
7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one	DMY027P	Discovery agent	N.A.	Investigative	[6]
7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one	DM4VQN8	Discovery agent	N.A.	Investigative	[6]
7-Mercapto-heptanoic acid benzothiazol-2-ylamide	DMPYTHV	Discovery agent	N.A.	Investigative	[12]
7-Mercapto-heptanoic acid biphenyl-3-ylamide	DMEQKPO	Discovery agent	N.A.	Investigative	[12]
7-Mercapto-heptanoic acid biphenyl-4-ylamide	DMJMOUK	Discovery agent	N.A.	Investigative	[12]
7-Mercapto-heptanoic acid phenylamide	DM4912P	Discovery agent	N.A.	Investigative	[12]
7-Mercapto-heptanoic acid pyridin-3-ylamide	DMQ9PLA	Discovery agent	N.A.	Investigative	[12]
7-Mercapto-heptanoic acid quinolin-3-ylamide	DMTAGJ1	Discovery agent	N.A.	Investigative	[12]
7-mercapto-N-(4-phenylthiazol-2-yl)heptanamide	DM03XYF	Discovery agent	N.A.	Investigative	[7]
8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one	DM23XGW	Discovery agent	N.A.	Investigative	[6]
8-Mercapto-octanoic acid phenylamide	DMD3FWU	Discovery agent	N.A.	Investigative	[12]
8-Oxo-8-phenyl-octanoic acid	DMXDQ25	Discovery agent	N.A.	Investigative	[13]
8-Oxo-8-phenyl-octanoic acid hydroxyamide	DMWM1UL	Discovery agent	N.A.	Investigative	[11]
9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide	DMVBCID	Discovery agent	N.A.	Investigative	[11]
9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one	DMIY3D6	Discovery agent	N.A.	Investigative	[11]
Cyclo(-L-Am7(S2Py)-A2in-L-Ala-D-Pro-)	DMZF35W	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Pro-)	DMIVREK	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Tic-)	DMLBECR	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ph4-D-Pro-)	DMA76KW	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ph5-D-Pro-)	DMLNJ0O	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Phe-D-Pro-)	DMTVMWA	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Phg-D-Pro-)	DMUSEDF	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ser(Bzl)-D-Pro-)	DMSEQ0W	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ser-D-Pro-)	DMBKP48	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-D-2MePhe-L-Ala-D-Pro-)	DMVY89X	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-D-A1in-L-Ala-D-Pro-)	DMTDIM9	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-L-2MePhe-L-Ala-D-Pro-)	DMV23XD	Discovery agent	N.A.	Investigative	[18]
Cyclo(-L-Am7(S2Py)-L-A1in-L-Ala-D-Pro-)	DM0VIH4	Discovery agent	N.A.	Investigative	[18]
Cyclostellettamine derivative	DMFTDPQ	Discovery agent	N.A.	Investigative	[19]
droxinostat	DM5IA9W	Discovery agent	N.A.	Investigative	[20]
IKH-25	DM94AIL	Solid tumour/cancer	2A00-2F9Z	Investigative	[21]
N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide	DM0GOPV	Discovery agent	N.A.	Investigative	[22]
N-(2-Mercapto-ethyl)-N'-phenyl-succinamide	DMJLFOQ	Discovery agent	N.A.	Investigative	[22]
N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide	DMSUW7M	Discovery agent	N.A.	Investigative	[11]
N-(6-Hydroxycarbamoyl-hexyl)-benzamide	DMIZVMT	Discovery agent	N.A.	Investigative	[13]
N-(6-Mercapto-hexyl)-benzamide	DM01Y37	Discovery agent	N.A.	Investigative	[12]
N-(biphenyl-3-yl)-6-(sulfamoylamino)hexanamide	DMRCYB8	Discovery agent	N.A.	Investigative	[23]
N-(quinolin-3-yl)-6-(sulfamoylamino)hexanamide	DMYEQXH	Discovery agent	N.A.	Investigative	[23]
N-(quinolin-6-yl)-6-(sulfamoylamino)hexanamide	DMFC3XI	Discovery agent	N.A.	Investigative	[23]
N-(quinolin-8-yl)-6-(sulfamoylamino)hexanamide	DML8EVA	Discovery agent	N.A.	Investigative	[23]
N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide	DMCN91A	Discovery agent	N.A.	Investigative	[9]
N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide	DMVK2Y3	Discovery agent	N.A.	Investigative	[9]
N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide	DMHEQ41	Discovery agent	N.A.	Investigative	[9]
N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide	DMUOCQB	Discovery agent	N.A.	Investigative	[9]
N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide	DMVEOBY	Discovery agent	N.A.	Investigative	[9]
N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide	DMISRMT	Discovery agent	N.A.	Investigative	[9]
N-Hydroxy-4-(pentanoylamino-methyl)-benzamide	DMGTNQY	Discovery agent	N.A.	Investigative	[10]
N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide	DMDUOH4	Discovery agent	N.A.	Investigative	[10]
N-Hydroxy-4-phenylacetylamino-benzamide	DMCRU17	Discovery agent	N.A.	Investigative	[9]
N-phenyl-6-(sulfamoylamino)hexanamide	DMRHKF8	Discovery agent	N.A.	Investigative	[23]
N-[5-(Formyl-hydroxy-amino)-pentyl]-benzamide	DMH7QOF	Discovery agent	N.A.	Investigative	[24]
N1-(biphenyl-3-yl)-N8-hydroxyoctanediamide	DMMQXON	Discovery agent	N.A.	Investigative	[23]
N1-(biphenyl-4-yl)-N8-hydroxyoctanediamide	DMZA8NC	Discovery agent	N.A.	Investigative	[25]
N1-hydroxy-N8-(4-phenylthiazol-2-yl)octanediamide	DMOZARM	Discovery agent	N.A.	Investigative	[25]
nexturastat A	DM6NS7H	Discovery agent	N.A.	Investigative	[26]
NILTUBACIN	DM0QJSO	Discovery agent	N.A.	Investigative	[14]
NQN-1	DMAXHLK	Discovery agent	N.A.	Investigative	[27]
Octanedioic acid bis-hydroxyamide	DMJNQ9K	Discovery agent	N.A.	Investigative	[28]
Octanedioic acid hydroxyamide pyridin-2-ylamide	DMHNWS1	Discovery agent	N.A.	Investigative	[13]
Octanedioic acid hydroxyamide pyridin-4-ylamide	DM945RK	Discovery agent	N.A.	Investigative	[13]
PMID19111466C7d	DMVTXKI	Discovery agent	N.A.	Investigative	[29]
PMID20947351C16	DM02YSE	Discovery agent	N.A.	Investigative	[16]
PSAMMAPLIN A	DM6T0IQ	Discovery agent	N.A.	Investigative	[11]
santacruzamate A	DMFAM7P	Discovery agent	N.A.	Investigative	[30]
ST-2741	DM73E0G	Discovery agent	N.A.	Investigative	[31]
ST-2986	DMNERM6	Discovery agent	N.A.	Investigative	[32]
ST-2987	DMWXTM8	Solid tumour/cancer	2A00-2F9Z	Investigative	[32]
ST-3050	DM19K2D	Discovery agent	N.A.	Investigative	[32]
Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester	DMBOKSF	Discovery agent	N.A.	Investigative	[12]
Tubacin	DMYR8SG	Multiple myeloma	2A83	Investigative	[33]
UCL-67022	DMFYUMX	Multiple myeloma	2A83	Investigative	[21]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Multiple myeloma	2C82	Bone marrow	6.91E-02	0.27	0.79

References

• [1] Promising therapies in multiple myeloma. Blood. 2015 July 16; 126(3): 300-310.
• [2] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [3] Novel histone deacetylase 6 (HDAC6) selective inhibitors: a patent evaluation (WO2014181137).Expert Opin Ther Pat. 2017 Mar;27(3):229-236.
• [4] HDAC inhibitors: a 2013-2017 patent survey.Expert Opin Ther Pat. 2018 Apr 19:1-17.
• [5] Sulfonamide inhibitors: a patent review 2013-present.Expert Opin Ther Pat. 2018 Jul;28(7):541-549.
• [6] Heterocyclic ketones as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13.
• [7] Design, synthesis, structure--selectivity relationship, and effect on human cancer cells of a novel series of histone deacetylase 6-selective inhib... J Med Chem. 2007 Nov 1;50(22):5425-38.
• [8] New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7.
• [9] Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. J Med Chem. 2005 Aug 25;48(17):5530-5.
• [10] Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. J Med Chem. 2004 Jan 15;47(2):467-74.
• [11] Histone deacetylase inhibitors. J Med Chem. 2003 Nov 20;46(24):5097-116.
• [12] Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxama... J Med Chem. 2005 Feb 24;48(4):1019-32.
• [13] Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. J Med Chem. 2002 Feb 14;45(4):753-7.
• [14] Chemical phylogenetics of histone deacetylases. Nat Chem Biol. 2010 Mar;6(3):238-243.
• [15] Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81.
• [16] Inhibitors selective for HDAC6 in enzymes and cells. Bioorg Med Chem Lett. 2010 Dec 1;20(23):7067-70.
• [17] Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. J Med Chem. 2006 Jan 26;49(2):800-5.
• [18] Molecular design of histone deacetylase inhibitors by aromatic ring shifting in chlamydocin framework. Bioorg Med Chem. 2007 Dec 15;15(24):7830-9.
• [19] Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20.
• [20] Selective inhibition of histone deacetylases sensitizes malignant cells to death receptor ligands. Mol Cancer Ther. 2010 Jan;9(1):246-56.
• [21] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2618).
• [22] Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72.
• [23] Sulfamides as novel histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):336-40.
• [24] Design, synthesis, and activity of HDAC inhibitors with a N-formyl hydroxylamine head group. Bioorg Med Chem Lett. 2004 Jan 19;14(2):449-53.
• [25] Isoxazole moiety in the linker region of HDAC inhibitors adjacent to the Zn-chelating group: effects on HDAC biology and antiproliferative activity. Bioorg Med Chem Lett. 2009 Jun 1;19(11):3023-6.
• [26] Selective histone deacetylase 6 inhibitors bearing substituted urea linkers inhibit melanoma cell growth. J Med Chem. 2012 Nov 26;55(22):9891-9.
• [27] A novel class of small molecule inhibitors of HDAC6. ACS Chem Biol. 2012 Feb 17;7(2):331-9.
• [28] Structure-activity relationships on phenylalanine-containing inhibitors of histone deacetylase: in vitro enzyme inhibition, induction of differenti... J Med Chem. 2002 Jul 18;45(15):3296-309.
• [29] Novel HDAC6 isoform selective chiral small molecule histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Feb 1;19(3):688-92.
• [30] Santacruzamate A, a potent and selective histone deacetylase inhibitor from the Panamanian marine cyanobacterium cf. Symploca sp. J Nat Prod. 2013 Nov 22;76(11):2026-33.
• [31] Exploring bis-(indolyl)methane moiety as an alternative and innovative CAP group in the design of histone deacetylase (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 May 15;19(10):2840-3.
• [32] N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9.
• [33] Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.