Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5ZKDI)

DTT Name Histone deacetylase 6 (HDAC6)
Synonyms KIAA0901; JM21; HD6
Gene Name HDAC6
DTT Type
Clinical trial target
 [1]
Related Disease
Multiple myeloma [ICD-11: 2A83]
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
BioChemical Class
Carbon-nitrogen hydrolase
UniProt ID
HDAC6_HUMAN
TTD ID
T22274
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 3.5.1.98
Sequence
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
Function
Gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).
KEGG Pathway
( )
( )
Reactome Pathway
Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606 )
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862 )
Assembly of the primary cilium (R-HSA-5617833 )
NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947 )
BioCyc Pathway
MetaCyc:HS01799-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Citarinostat DMQLODU Multiple myeloma 2A83 Phase 1 [2]
KA2507 DMW0H9Y Solid tumour/cancer 2A00-2F9Z Phase 1 [2]
------------------------------------------------------------------------------------
77 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Diaryl amine derivative 2 DMRBYAV N. A. N. A. Patented [3]
Diaryl amine derivative 3 DMLBN1T N. A. N. A. Patented [3]
Diaryl amine derivative 4 DMZL6AX N. A. N. A. Patented [3]
PMID28092474-Compound-32a DMGZ61E N. A. N. A. Patented [3]
PMID28092474-Compound-32b DMT2B5A N. A. N. A. Patented [3]
PMID28092474-Compound-32c DMGA3XL N. A. N. A. Patented [3]
PMID28092474-Compound-32d DMW21U4 N. A. N. A. Patented [3]
PMID28092474-Compound-32e DM8NHQS N. A. N. A. Patented [3]
PMID28092474-Compound-32f DMEIZ6Y N. A. N. A. Patented [3]
PMID28092474-Compound-32g DMTKLEP N. A. N. A. Patented [3]
PMID28092474-Compound-32h DME1WHT N. A. N. A. Patented [3]
PMID28092474-Compound-32i DMN3ZEF N. A. N. A. Patented [3]
PMID28092474-Compound-32j DMSGWTX N. A. N. A. Patented [3]
PMID28092474-Compound-32k DMHSJ65 N. A. N. A. Patented [3]
PMID28092474-Compound-32l DMSP5IA N. A. N. A. Patented [3]
PMID28092474-Compound-32m DMADMWB N. A. N. A. Patented [3]
PMID28092474-Compound-32n DMJO3RW N. A. N. A. Patented [3]
PMID28092474-Compound-32o DMV9BQN N. A. N. A. Patented [3]
PMID28092474-Compound-32p DM4ZO21 N. A. N. A. Patented [3]
PMID28092474-Compound-32q DMEASZY N. A. N. A. Patented [3]
PMID28092474-Compound-32r DMLTKMS N. A. N. A. Patented [3]
PMID28092474-Compound-32s DMS103B N. A. N. A. Patented [3]
PMID28092474-Compound-32t DM2JF0T N. A. N. A. Patented [3]
PMID28092474-Compound-32u DM805ZN N. A. N. A. Patented [3]
PMID28092474-Compound-32v DMHV3ES N. A. N. A. Patented [3]
PMID28092474-Compound-32x DML79XQ N. A. N. A. Patented [3]
PMID28092474-Compound-32y DMLR03U N. A. N. A. Patented [3]
PMID28092474-Compound-32z DMEPWGH N. A. N. A. Patented [3]
PMID28092474-Compound-33a DM7GH4Y N. A. N. A. Patented [3]
PMID28092474-Compound-33b DMIJQZV N. A. N. A. Patented [3]
PMID28092474-Compound-33c DM51JP6 N. A. N. A. Patented [3]
PMID28092474-Compound-33d DMW38MK N. A. N. A. Patented [3]
PMID28092474-Compound-33e DMGTSXL N. A. N. A. Patented [3]
PMID28092474-Compound-33f DMA360M N. A. N. A. Patented [3]
PMID28092474-Compound-33g DM18DY6 N. A. N. A. Patented [3]
PMID28092474-Compound-33h DM1DN6V N. A. N. A. Patented [3]
PMID28092474-Compound-33i DM16E95 N. A. N. A. Patented [3]
PMID28092474-Compound-33j DMNTRIZ N. A. N. A. Patented [3]
PMID28092474-Compound-33k DMF2ZNT N. A. N. A. Patented [3]
PMID28092474-Compound-33l DMPJSB2 N. A. N. A. Patented [3]
PMID28092474-Compound-33m DMXSPT9 N. A. N. A. Patented [3]
PMID28092474-Compound-33o DM6DJZ7 N. A. N. A. Patented [3]
PMID28092474-Compound-33p DMI8ZBK N. A. N. A. Patented [3]
PMID28092474-Compound-34a DMXQE7C N. A. N. A. Patented [3]
PMID28092474-Compound-34b DM6X2CO N. A. N. A. Patented [3]
PMID28092474-Compound-34c DMMI7DY N. A. N. A. Patented [3]
PMID29671355-Compound-11 DMNKABH N. A. N. A. Patented [4]
PMID29671355-Compound-13 DMALXYR N. A. N. A. Patented [4]
PMID29671355-Compound-14 DM8UMQH N. A. N. A. Patented [4]
PMID29671355-Compound-15 DMAEPD4 N. A. N. A. Patented [4]
PMID29671355-Compound-16 DM2C6ZF N. A. N. A. Patented [4]
PMID29671355-Compound-18 DMUY53P N. A. N. A. Patented [4]
PMID29671355-Compound-19 DM9LMNB N. A. N. A. Patented [4]
PMID29671355-Compound-21 DMPJN0M N. A. N. A. Patented [4]
PMID29671355-Compound-22 DMRGV83 N. A. N. A. Patented [4]
PMID29671355-Compound-23 DMUBOEX N. A. N. A. Patented [4]
PMID29671355-Compound-24 DMCIGJ1 N. A. N. A. Patented [4]
PMID29671355-Compound-25 DMPV0KZ N. A. N. A. Patented [4]
PMID29671355-Compound-26 DM5K6MG N. A. N. A. Patented [4]
PMID29671355-Compound-27 DMP7S9E N. A. N. A. Patented [4]
PMID29671355-Compound-28 DMLXSHW N. A. N. A. Patented [4]
PMID29671355-Compound-31 DM3H78D N. A. N. A. Patented [4]
PMID29671355-Compound-38a DMYATB5 N. A. N. A. Patented [4]
PMID29671355-Compound-38b DMYXE4J N. A. N. A. Patented [4]
PMID29671355-Compound-39 DM6EJ93 N. A. N. A. Patented [4]
PMID29671355-Compound-43 DMVPMWJ N. A. N. A. Patented [4]
PMID29671355-Compound-44 DM80A3V N. A. N. A. Patented [4]
PMID29671355-Compound-56 DM0VBMI N. A. N. A. Patented [4]
PMID29671355-Compound-61 DMXH1G3 N. A. N. A. Patented [4]
PMID29671355-Compound-62 DMWRS34 N. A. N. A. Patented [4]
PMID29671355-Compound-65a DMY3Q58 N. A. N. A. Patented [4]
PMID29671355-Compound-67 DM1RPL4 N. A. N. A. Patented [4]
PMID29671355-Compound-73 DMCNF36 N. A. N. A. Patented [4]
PMID29671355-Compound-74 DM49YTU N. A. N. A. Patented [4]
PMID29671355-Compound-8 DM7YQJK N. A. N. A. Patented [4]
PMID29671355-Compound-9 DMXL96M N. A. N. A. Patented [4]
Sulfonamide derivative 16 DMTFNGM N. A. N. A. Patented [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 77 Patented Agent(s)
92 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one DM5LSY9 Discovery agent N.A. Investigative [6]
(S)-2-Amino-N-cyclopentyl-7-mercaptoheptanamide DMDWFHV Discovery agent N.A. Investigative [7]
2-(methylsulfonylthio)ethyl 2-propylpentanoate DMM52D3 Discovery agent N.A. Investigative [8]
4-Benzoylamino-N-hydroxy-benzamide DMYBPFS Discovery agent N.A. Investigative [9]
4-Butyrylamino-N-hydroxy-benzamide DMRY6B4 Discovery agent N.A. Investigative [10]
4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide DM5AVG3 Discovery agent N.A. Investigative [11]
4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide DM0M8G5 Discovery agent N.A. Investigative [12]
4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide DMULOHZ Discovery agent N.A. Investigative [13]
4-Phenylbutyrohydroxamic acid DMCZKN7 Discovery agent N.A. Investigative [14]
5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide DM6CRVS Discovery agent N.A. Investigative [15]
5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione DM7KQXL Discovery agent N.A. Investigative [8]
5-Mercapto-pentanoic acid phenylamide DMET3OJ Discovery agent N.A. Investigative [12]
6-(2-Bromo-acetylamino)-hexanoic acid phenylamide DM9LKXD Discovery agent N.A. Investigative [12]
6-(9H-carbazol-9-yl)-N-hydroxyhexanamide DMVMDJ3 Discovery agent N.A. Investigative [16]
6-benzenesulfinylhexanoic acid hydroxamide DM2I95Z Discovery agent N.A. Investigative [17]
6-benzenesulfonylhexanoic acid hydroxamide DMY9IK8 Discovery agent N.A. Investigative [17]
6-Mercapto-hexanoic acid phenylamide DMD2FW9 Discovery agent N.A. Investigative [12]
6-Phenoxy-hexane-1-thiol DMVYIN2 Discovery agent N.A. Investigative [12]
6-phenylsulfanylhexanoic acid hydroxamide DM3OLM6 Discovery agent N.A. Investigative [17]
7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one DMLCGSY Discovery agent N.A. Investigative [6]
7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one DM28GZ7 Discovery agent N.A. Investigative [11]
7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one DMY027P Discovery agent N.A. Investigative [6]
7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one DM4VQN8 Discovery agent N.A. Investigative [6]
7-Mercapto-heptanoic acid benzothiazol-2-ylamide DMPYTHV Discovery agent N.A. Investigative [12]
7-Mercapto-heptanoic acid biphenyl-3-ylamide DMEQKPO Discovery agent N.A. Investigative [12]
7-Mercapto-heptanoic acid biphenyl-4-ylamide DMJMOUK Discovery agent N.A. Investigative [12]
7-Mercapto-heptanoic acid phenylamide DM4912P Discovery agent N.A. Investigative [12]
7-Mercapto-heptanoic acid pyridin-3-ylamide DMQ9PLA Discovery agent N.A. Investigative [12]
7-Mercapto-heptanoic acid quinolin-3-ylamide DMTAGJ1 Discovery agent N.A. Investigative [12]
7-mercapto-N-(4-phenylthiazol-2-yl)heptanamide DM03XYF Discovery agent N.A. Investigative [7]
8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one DM23XGW Discovery agent N.A. Investigative [6]
8-Mercapto-octanoic acid phenylamide DMD3FWU Discovery agent N.A. Investigative [12]
8-Oxo-8-phenyl-octanoic acid DMXDQ25 Discovery agent N.A. Investigative [13]
8-Oxo-8-phenyl-octanoic acid hydroxyamide DMWM1UL Discovery agent N.A. Investigative [11]
9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide DMVBCID Discovery agent N.A. Investigative [11]
9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one DMIY3D6 Discovery agent N.A. Investigative [11]
Cyclo(-L-Am7(S2Py)-A2in-L-Ala-D-Pro-) DMZF35W Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Pro-) DMIVREK Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Tic-) DMLBECR Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ph4-D-Pro-) DMA76KW Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ph5-D-Pro-) DMLNJ0O Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Phe-D-Pro-) DMTVMWA Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Phg-D-Pro-) DMUSEDF Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ser(Bzl)-D-Pro-) DMSEQ0W Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-Aib-L-Ser-D-Pro-) DMBKP48 Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-D-2MePhe-L-Ala-D-Pro-) DMVY89X Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-D-A1in-L-Ala-D-Pro-) DMTDIM9 Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-L-2MePhe-L-Ala-D-Pro-) DMV23XD Discovery agent N.A. Investigative [18]
Cyclo(-L-Am7(S2Py)-L-A1in-L-Ala-D-Pro-) DM0VIH4 Discovery agent N.A. Investigative [18]
Cyclostellettamine derivative DMFTDPQ Discovery agent N.A. Investigative [19]
droxinostat DM5IA9W Discovery agent N.A. Investigative [20]
IKH-25 DM94AIL Solid tumour/cancer 2A00-2F9Z Investigative [21]
N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide DM0GOPV Discovery agent N.A. Investigative [22]
N-(2-Mercapto-ethyl)-N'-phenyl-succinamide DMJLFOQ Discovery agent N.A. Investigative [22]
N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide DMSUW7M Discovery agent N.A. Investigative [11]
N-(6-Hydroxycarbamoyl-hexyl)-benzamide DMIZVMT Discovery agent N.A. Investigative [13]
N-(6-Mercapto-hexyl)-benzamide DM01Y37 Discovery agent N.A. Investigative [12]
N-(biphenyl-3-yl)-6-(sulfamoylamino)hexanamide DMRCYB8 Discovery agent N.A. Investigative [23]
N-(quinolin-3-yl)-6-(sulfamoylamino)hexanamide DMYEQXH Discovery agent N.A. Investigative [23]
N-(quinolin-6-yl)-6-(sulfamoylamino)hexanamide DMFC3XI Discovery agent N.A. Investigative [23]
N-(quinolin-8-yl)-6-(sulfamoylamino)hexanamide DML8EVA Discovery agent N.A. Investigative [23]
N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide DMCN91A Discovery agent N.A. Investigative [9]
N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide DMVK2Y3 Discovery agent N.A. Investigative [9]
N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide DMHEQ41 Discovery agent N.A. Investigative [9]
N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide DMUOCQB Discovery agent N.A. Investigative [9]
N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide DMVEOBY Discovery agent N.A. Investigative [9]
N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide DMISRMT Discovery agent N.A. Investigative [9]
N-Hydroxy-4-(pentanoylamino-methyl)-benzamide DMGTNQY Discovery agent N.A. Investigative [10]
N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide DMDUOH4 Discovery agent N.A. Investigative [10]
N-Hydroxy-4-phenylacetylamino-benzamide DMCRU17 Discovery agent N.A. Investigative [9]
N-phenyl-6-(sulfamoylamino)hexanamide DMRHKF8 Discovery agent N.A. Investigative [23]
N-[5-(Formyl-hydroxy-amino)-pentyl]-benzamide DMH7QOF Discovery agent N.A. Investigative [24]
N1-(biphenyl-3-yl)-N8-hydroxyoctanediamide DMMQXON Discovery agent N.A. Investigative [23]
N1-(biphenyl-4-yl)-N8-hydroxyoctanediamide DMZA8NC Discovery agent N.A. Investigative [25]
N1-hydroxy-N8-(4-phenylthiazol-2-yl)octanediamide DMOZARM Discovery agent N.A. Investigative [25]
nexturastat A DM6NS7H Discovery agent N.A. Investigative [26]
NILTUBACIN DM0QJSO Discovery agent N.A. Investigative [14]
NQN-1 DMAXHLK Discovery agent N.A. Investigative [27]
Octanedioic acid bis-hydroxyamide DMJNQ9K Discovery agent N.A. Investigative [28]
Octanedioic acid hydroxyamide pyridin-2-ylamide DMHNWS1 Discovery agent N.A. Investigative [13]
Octanedioic acid hydroxyamide pyridin-4-ylamide DM945RK Discovery agent N.A. Investigative [13]
PMID19111466C7d DMVTXKI Discovery agent N.A. Investigative [29]
PMID20947351C16 DM02YSE Discovery agent N.A. Investigative [16]
PSAMMAPLIN A DM6T0IQ Discovery agent N.A. Investigative [11]
santacruzamate A DMFAM7P Discovery agent N.A. Investigative [30]
ST-2741 DM73E0G Discovery agent N.A. Investigative [31]
ST-2986 DMNERM6 Discovery agent N.A. Investigative [32]
ST-2987 DMWXTM8 Solid tumour/cancer 2A00-2F9Z Investigative [32]
ST-3050 DM19K2D Discovery agent N.A. Investigative [32]
Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester DMBOKSF Discovery agent N.A. Investigative [12]
Tubacin DMYR8SG Multiple myeloma 2A83 Investigative [33], [34]
UCL-67022 DMFYUMX Multiple myeloma 2A83 Investigative [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 92 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Multiple myeloma 2C82 Bone marrow 6.91E-02 0.27 0.79
------------------------------------------------------------------------------------

References

1 Promising therapies in multiple myeloma. Blood. 2015 July 16; 126(3): 300-310.
2 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
3 Novel histone deacetylase 6 (HDAC6) selective inhibitors: a patent evaluation (WO2014181137).Expert Opin Ther Pat. 2017 Mar;27(3):229-236.
4 HDAC inhibitors: a 2013-2017 patent survey.Expert Opin Ther Pat. 2018 Apr 19:1-17.
5 Sulfonamide inhibitors: a patent review 2013-present.Expert Opin Ther Pat. 2018 Jul;28(7):541-549.
6 Heterocyclic ketones as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13.
7 Design, synthesis, structure--selectivity relationship, and effect on human cancer cells of a novel series of histone deacetylase 6-selective inhib... J Med Chem. 2007 Nov 1;50(22):5425-38.
8 New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7.
9 Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. J Med Chem. 2005 Aug 25;48(17):5530-5.
10 Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. J Med Chem. 2004 Jan 15;47(2):467-74.
11 Histone deacetylase inhibitors. J Med Chem. 2003 Nov 20;46(24):5097-116.
12 Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxama... J Med Chem. 2005 Feb 24;48(4):1019-32.
13 Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. J Med Chem. 2002 Feb 14;45(4):753-7.
14 Chemical phylogenetics of histone deacetylases. Nat Chem Biol. 2010 Mar;6(3):238-243.
15 Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81.
16 Inhibitors selective for HDAC6 in enzymes and cells. Bioorg Med Chem Lett. 2010 Dec 1;20(23):7067-70.
17 Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. J Med Chem. 2006 Jan 26;49(2):800-5.
18 Molecular design of histone deacetylase inhibitors by aromatic ring shifting in chlamydocin framework. Bioorg Med Chem. 2007 Dec 15;15(24):7830-9.
19 Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20.
20 Selective inhibition of histone deacetylases sensitizes malignant cells to death receptor ligands. Mol Cancer Ther. 2010 Jan;9(1):246-56.
21 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2618).
22 Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72.
23 Sulfamides as novel histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):336-40.
24 Design, synthesis, and activity of HDAC inhibitors with a N-formyl hydroxylamine head group. Bioorg Med Chem Lett. 2004 Jan 19;14(2):449-53.
25 Isoxazole moiety in the linker region of HDAC inhibitors adjacent to the Zn-chelating group: effects on HDAC biology and antiproliferative activity. Bioorg Med Chem Lett. 2009 Jun 1;19(11):3023-6.
26 Selective histone deacetylase 6 inhibitors bearing substituted urea linkers inhibit melanoma cell growth. J Med Chem. 2012 Nov 26;55(22):9891-9.
27 A novel class of small molecule inhibitors of HDAC6. ACS Chem Biol. 2012 Feb 17;7(2):331-9.
28 Structure-activity relationships on phenylalanine-containing inhibitors of histone deacetylase: in vitro enzyme inhibition, induction of differenti... J Med Chem. 2002 Jul 18;45(15):3296-309.
29 Novel HDAC6 isoform selective chiral small molecule histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Feb 1;19(3):688-92.
30 Santacruzamate A, a potent and selective histone deacetylase inhibitor from the Panamanian marine cyanobacterium cf. Symploca sp. J Nat Prod. 2013 Nov 22;76(11):2026-33.
31 Exploring bis-(indolyl)methane moiety as an alternative and innovative CAP group in the design of histone deacetylase (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 May 15;19(10):2840-3.
32 N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9.
33 Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.
34 Anticancer activities of histone deacetylase inhibitors. Nat Rev Drug Discov. 2006 Sep;5(9):769-84.