Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTB2MXP)

• DTT Name: Angiotensinogenase renin (REN)
• Synonyms: Renin; Angiotensinogenase
• Gene Name: REN
• DTT Type: Successful target; [1]
• BioChemical Class: Peptidase
• UniProt ID: RENI_HUMAN
• TTD ID: T61622
• EC Number: EC 3.4.23.15
• Sequence:
  MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
  SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
  YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
  PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
  QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
  STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
  LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
• Function: Renin is a highly specific endopeptidase, whose only knownfunction is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
• KEGG Pathway: Renin-angiotensin system (hsa04614)
• Reactome Pathway: Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377)

Molecular Interaction Atlas (MIA) of This DTT

2 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aliskiren	DM1BV7W	Hypertension	BA00-BA04	Approved	[1]
Remikiren	DMNAKLY	Hypertension	BA00-BA04	Approved	[2]

8 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CP-80794	DMT3ORQ	Hypertension	BA00-BA04	Phase 2	[3]
SPH3127	DMYL6RA	Ulcerative colitis	DD71	Phase 2	[4]
SPP-600	DMOVQP8	Hypertension	BA00-BA04	Phase 2	[5]
SR-43845	DMTOCIV	Glaucoma/ocular hypertension	9C61	Phase 2	[6]
TAK-272	DM81UAZ	Type-2 diabetes	5A11	Phase 2	[7]
ACT-178882	DMOZ3AT	Cardiovascular disease	BA00-BE2Z	Phase 1	[8]
CARD-024	DM4SNK8	Cardiovascular disease	BA00-BE2Z	Phase 1	[9]
VTP-27999	DMQEOD6	Hypertension	BA00-BA04	Phase 1	[10]

15 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Enalkiren	DMDAS5B	Glaucoma/ocular hypertension	9C61	Discontinued in Phase 2	[11]
FK-906	DMTEW80	Hypertension	BA00-BA04	Discontinued in Phase 2	[12]
ZANKIREN	DM9F650	Hypertension	BA00-BA04	Discontinued in Phase 2	[13]
RS-8891	DM4P5WO	Hypertension	BA00-BA04	Discontinued in Phase 1	[14]
SPP-1148	DMWQKEN	Hypertension	BA00-BA04	Discontinued in Phase 1	[10]
SPP-676	DMKEHGT	Hypertension	BA00-BA04	Discontinued in Phase 1	[10]
A-74273	DMBEIFL	Hypertension	BA00-BA04	Terminated	[15]
BILA-2157BS	DMRV4UL	Hypertension	BA00-BA04	Terminated	[16]
Ciprokiren	DM0NJMG	Hypertension	BA00-BA04	Terminated	[17]
ES-1005	DMRP7BX	Hypertension	BA00-BA04	Terminated	[18]
JTP-2724	DMG7B61	Hypertension	BA00-BA04	Terminated	[19]
JTP-4761	DM6TXKR	Hypertension	BA00-BA04	Terminated	[20]
KRI-1314	DM4QHNG	Hypertension	BA00-BA04	Terminated	[21]
SC-56525	DM25MUA	Hypertension	BA00-BA04	Terminated	[22]
SQ-33800	DMMRWKP	Hypertension	BA00-BA04	Terminated	[23]

27 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(H-261)Boc-His-Pro-Phe-His-Leu(OH)-Val-Ile-His-OH	DMVKJ0H	Discovery agent	N.A.	Investigative	[24]
1-Hydroxy-2-Amino-3-Cyclohexylpropane	DM9EWN8	Discovery agent	N.A.	Investigative	[25]
1-Hydroxy-3-Methylbutane	DMZ8IL9	Discovery agent	N.A.	Investigative	[25]
1-Methyl-2-Oxy-5,5-Dimethyl Pyrrolidine	DM5GELS	Discovery agent	N.A.	Investigative	[25]
2-Cyclopropylmethylenepropanal	DM0W2QB	Discovery agent	N.A.	Investigative	[25]
2-Methyl-3-(2-Aminothiazolo)Propanal	DM3DNFQ	Discovery agent	N.A.	Investigative	[26]
3-Phenyl-1,2-Propandiol	DMU9WGT	Discovery agent	N.A.	Investigative	[25]
CP-305202	DMME6K2	Discovery agent	N.A.	Investigative	[27]
Dimethylformamide	DML6O4N	Discovery agent	N.A.	Investigative	[28]
ES-6864	DMSNM5O	Hypertension	BA00-BA04	Investigative	[29]
Glu-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro	DM1Q83B	Discovery agent	N.A.	Investigative	[30]
Iva-His-Pro-Phe-His-ACHPA-Leu-Phe-NH2	DMFMYIH	Discovery agent	N.A.	Investigative	[31]
Iva-His-Pro-Phe-His-AHPPA-Leu-Phe-NH2	DMZTIU3	Discovery agent	N.A.	Investigative	[31]
Iva-His-Pro-Phe-His-Sta-Leu-Phe-NH2	DM92QIW	Discovery agent	N.A.	Investigative	[31]
JT-2724	DMD9W0B	Discovery agent	N.A.	Investigative	[32]
N-Methyl-N-(Methylbenzyl)Formamide	DMYPEX3	Discovery agent	N.A.	Investigative	[26]
PP1-Pro-Phe-N-MeHis-LVA-Ile-Amp-(O)	DMYA5CB	Discovery agent	N.A.	Investigative	[33]
PP2-Pro-Phe-N-MeHis-LVA-Ile-Amp-(O)	DM3NUKX	Discovery agent	N.A.	Investigative	[33]
Pro-His-Pro-His-Leu-Phe-Val-Tyr	DMZH0KY	Discovery agent	N.A.	Investigative	[30]
Pro-His-Pro-His-Phe-Phe-Val-Tyr	DMD3WVO	Discovery agent	N.A.	Investigative	[30]
Pro-His-Pro-His-Phe-Phe-Val-Tyr-Lys	DMNDUI3	Discovery agent	N.A.	Investigative	[30]
Pro-His-Pro-Phe-His-Leu(CH2NH)Val-Ile-His-Lys	DM26VFX	Discovery agent	N.A.	Investigative	[34]
Ro-65-7219	DM6S742	Discovery agent	N.A.	Investigative	[27]
Ro-66-1168	DMPT01J	Discovery agent	N.A.	Investigative	[13]
SPP-800	DMP5VN2	Hypertension	BA00-BA04	Investigative	[9]
Sul-Pro-Phe-N-MeHis-LVA-Ile-Amp	DMTEU0L	Discovery agent	N.A.	Investigative	[33]
Sul-Pro-Phe-N-MeHis-LVA-Ile-Amp-(O)	DMQB2CN	Discovery agent	N.A.	Investigative	[33]

References

• [1] Comparative effects of aliskiren-based and ramipril-based therapy on the renin system during long-term (6 months) treatment and withdrawal in patie... J Renin Angiotensin Aldosterone Syst. 2009 Sep;10(3):157-67.
• [2] Functional expression of the renin-angiotensin system in human podocytes. Am J Physiol Renal Physiol. 2006 Mar;290(3):F710-9.
• [3] Synergistic effect on reduction in blood pressure with coadministration of the renin inhibitor, CP-80,794, and the angiotensin converting enzyme inhibitor, captopril. J Cardiovasc Pharmacol. 1992 Jul;20(1):75-82.
• [4] Discovery of SPH3127: A Novel, Highly Potent, and Orally Active Direct Renin Inhibitor. J Med Chem. 2022 Aug 25;65(16):10882-10897.
• [5] Effect of SPP 635, a renin inhibitor, on intraocular pressure in glaucomatous monkey eyes. Exp Eye Res. 2012 Jan;94(1):146-9.
• [6] Effects of a renin inhibitor, SR 43845, and of captopril on blood pressure and plasma active renin in conscious sodium-replete macaca. J Hypertens Suppl. 1989 Apr;7(2):S33-5.
• [7] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033655)
• [8] Drug-drug interaction study of ACT-178882, a new renin inhibitor, and diltiazem in healthy subjects. Clin Drug Investig. 2013 Mar;33(3):207-13.
• [9] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2413).
• [10] New Developments in the Pharmacological Treatment of Hypertension: Dead-End or a Glimmer at the Horizon . Curr Hypertens Rep. 2015; 17(6): 42.
• [11] Comparative effects of three different potent renin inhibitors in primates. Hypertension. 1993 Jul;22(1):9-17.
• [12] Antihypertensive efficacy of FK906, a novel human renin inhibitor. Clin Ther. 1993 May-Jun;15(3):539-48.
• [13] Design and preparation of potent, nonpeptidic, bioavailable renin inhibitors. J Med Chem. 2009 Jun 25;52(12):3689-702.
• [14] Aliskiren, a novel oral renin inhibitor, provides dose-dependent efficacy and placebo-like tolerability in Japanese patients with hypertension. Hypertension Research (2006) 29, 997-1005. doi:10.1291/hypres.29.997
• [15] The orally active renin inhibitor A-74273. In vivo and in vitro morpholine ring metabolism in rats, dogs, and humans. Drug Metab Dispos. 1994 Nov-Dec;22(6):880-8.
• [16] Comparative studies on differential inhibition of the renin - angiotensin system in the anesthetized guinea pig. Can J Physiol Pharmacol. 1995 Oct;73(10):1512-8.
• [17] Ciprokiren (Ro 44-9375). A renin inhibitor with increasing effects on chronic treatment. Hypertension. 1994 Aug;24(2):163-9.
• [18] The effect of the renin inhibitor ES-1005 on the expression of the kidney renin gene in sodium-depleted marmosets. J Hypertens. 1990 Dec;8(12):1143-6.
• [19] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010026)
• [20] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005981)
• [21] KRI-1314: an orally effective inhibitor of human renin. Jpn J Pharmacol. 1993 Sep;63(1):109-19.
• [22] Effects of SC-56525, a potent, orally active renin inhibitor, in salt-depleted and renal hypertensive dogs. Hypertension. 1995 Jul;26(1):95-100.
• [23] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002406)
• [24] Renin inhibitors. Dipeptide analogues of angiotensinogen incorporating transition-state, nonpeptidic replacements at the scissile bond. J Med Chem. 1987 Oct;30(10):1729-37.
• [25] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [26] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [27] Direct renin inhibitors as a new therapy for hypertension. J Med Chem. 2010 Nov 11;53(21):7490-520.
• [28] Liver disease associated with occupational exposure to the solvent dimethylformamide. Ann Intern Med. 1988 May;108(5):680-6.
• [29] A highly potent and long-acting oral inhibitor of human renin. Hypertension. 1988 Jun;11(6 Pt 2):708-12.
• [30] Inhibition of the renin-angiotensin system. A new approach to the therapy of hypertension. J Med Chem. 1981 Apr;24(4):355-61.
• [31] Renin inhibitors. Syntheses of subnanomolar, competitive, transition-state analogue inhibitors containing a novel analogue of statine. J Med Chem. 1985 Dec;28(12):1779-90.
• [32] The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954.
• [33] Renin inhibitory peptides. Incorporation of polar, hydrophilic end groups into an active renin inhibitory peptide template and their evaluation in ... J Med Chem. 1991 Feb;34(2):633-42.
• [34] Synthesis and biological activity of some transition-state inhibitors of human renin. J Med Chem. 1988 Sep;31(9):1839-46.