Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTB7VAT)

DTT Name	Serum amyloid P-component (APCS)
Synonyms	SAP; APCS; 9.5S alpha-1-glycoprotein
Gene Name	APCS
DTT Type	Clinical trial target	[1]
BioChemical Class	Pentraxin family
UniProt ID	SAMP_HUMAN
TTD ID	T37742
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYS DLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESS SGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWD SVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Function	Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. May also function as a calcium-dependent lectin.
Reactome Pathway	Amyloid formation (R-HSA-977225 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Zinpentraxin alfa	DMNJAVV	Idiopathic pulmonary fibrosis	CB03.4	Phase 3	[2]
CPHPC	DM1ZGUX	Parkinson disease	8A00.0	Phase 1/2	[1]
GSK-2315698	DMOWTRL	Amyloidosis	5D00	Phase 1	[3]
GSK2398852	DMZ5A6D	Amyloidosis	5D00	Phase 1	[4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Parkinson's disease	8A00.0	Substantia nigra tissue	3.02E-01	-0.06	-0.21
------------------------------------------------------------------------------------

References

1	Interaction of serum amyloid P component with hexanoyl bis(D-proline) (CPHPC).Acta Crystallogr D Biol Crystallogr.2014 Aug;70(Pt 8):2232-40.
2	Safety and efficacy of zinpentraxin alfa as monotherapy or in combination with ruxolitinib in myelofibrosis: stage I of a phase II trial. Haematologica. 2023 Oct 1;108(10):2730-2742.
3	Target Mediated Drug Disposition Model of CPHPC in Patients with Systemic Amyloidosis. CPT Pharmacometrics Syst Pharmacol. 2015 February; 4(2): e15.
4	ClinicalTrials.gov (NCT01777243) A Study to Evaluate the Safety of GSK2398852 When Co-administered With GSK2315698 in Patients With Systemic Amyloidosis. U.S. National Institutes of Health.