Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBW580)

• DTT Name: TAX transcriptionally-activated glycoprotein 1 (OX40)
• Synonyms: Tumor necrosis factor ligand superfamily member 4; TNFSF4; OX40L; Glycoprotein Gp34; CD252
• Gene Name: TNFSF4
• DTT Type: Clinical trial target; [1]
• Related Disease:
  Breast cancer [ICD-11: 2C60-2C6Y]
  General pain disorder [ICD-11: 8E43]
• BioChemical Class: Cytokine: tumor necrosis factor
• UniProt ID: TNFL4_HUMAN
• TTD ID: T55860
• Sequence:
  MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
  SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ
  KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF
  CVL
• Function: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DTT

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AMG 386	DMQJXL4	Breast cancer	2C60-2C65	Phase 3	[1]
RG7888	DM2SWI8	Solid tumour/cancer	2A00-2F9Z	Phase 2	[2]
MEDI6383	DM1YSMD	Solid tumour/cancer	2A00-2F9Z	Phase 1	[3]
mRNA-2416	DMFTAWU	Lymphoma	2A80-2A86	Phase 1	[4]
mRNA-2752	DMUKBI2	Solid tumour/cancer	2A00-2F9Z	Phase 1	[5]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	9.04E-01	-0.12	-0.21

References

• [1] Clinical targeting of the TNF and TNFR superfamilies.Nat Rev Drug Discov.2013 Feb;12(2):147-68.
• [2] Anti-tumor efficacy and biomarker evaluation of agonistic anti-OX40 antibodies in preclinical models. J Immunother Cancer. 2014; 2(Suppl 3): P105.
• [3] J Clin Oncol 33, 2015 (suppl; abstr 3056).
• [4] Clinical pipeline report, company report or official report of Moderna Therapeutics.
• [5] Clinical pipeline report, company report or official report of Moderna Therapeutics.