Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTCEKVZ)

• DTT Name: Fibroblast growth factor-4 (FGF4)
• Synonyms: Transforming protein KS3; Heparinbinding growth factor 4; Heparin secretorytransforming protein 1; HST1; HST; HBGF4; Fibroblast growth factor 4; FGF4
• Gene Name: FGF4
• DTT Type: Successful target; [1]
• BioChemical Class: Heparin-binding growth factors family
• UniProt ID: FGF4_HUMAN
• TTD ID: T28076
• Sequence:
  MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
  AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
  VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
  LSKNGKTKKGNRVSPTMKVTHFLPRL
• Function: Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
• KEGG Pathway:
  MAPK signaling pathway (hsa04010)
  Ras signaling pathway (hsa04014)
  Rap1 signaling pathway (hsa04015)
  PI3K-Akt signaling pathway (hsa04151)
  Regulation of actin cytoskeleton (hsa04810)
  Pathways in cancer (hsa05200)
  Melanoma (hsa05218)
• Reactome Pathway:
  PIP3 activates AKT signaling (R-HSA-1257604)
  FGFR4 ligand binding and activation (R-HSA-190322)
  FGFR3c ligand binding and activation (R-HSA-190372)
  FGFR2c ligand binding and activation (R-HSA-190375)
  FGFR3 mutant receptor activation (R-HSA-2033514)
  Activated point mutants of FGFR2 (R-HSA-2033519)
  Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)
  Phospholipase C-mediated cascade (R-HSA-5654219)
  Phospholipase C-mediated cascade (R-HSA-5654221)
  Phospholipase C-mediated cascade (R-HSA-5654227)
  Phospholipase C-mediated cascade (R-HSA-5654228)
  SHC-mediated cascade (R-HSA-5654688)
  PI-3K cascade (R-HSA-5654689)
  FRS-mediated FGFR1 signaling (R-HSA-5654693)
  PI-3K cascade (R-HSA-5654695)
  SHC-mediated cascade (R-HSA-5654699)
  FRS-mediated FGFR2 signaling (R-HSA-5654700)
  SHC-mediated cascade (R-HSA-5654704)
  FRS-mediated FGFR3 signaling (R-HSA-5654706)
  PI-3K cascade (R-HSA-5654710)
  FRS-mediated FGFR4 signaling (R-HSA-5654712)
  SHC-mediated cascade (R-HSA-5654719)
  PI-3K cascade (R-HSA-5654720)
  Negative regulation of FGFR1 signaling (R-HSA-5654726)
  Negative regulation of FGFR2 signaling (R-HSA-5654727)
  Negative regulation of FGFR3 signaling (R-HSA-5654732)
  Negative regulation of FGFR4 signaling (R-HSA-5654733)
  RAF/MAP kinase cascade (R-HSA-5673001)
  PI3K Cascade (R-HSA-109704)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Pentosan Polysulfate	DM2HRKE	Interstitial cystitis	GC00.3	Approved	[1]

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ad5FGF-4	DMVLWG7	Angina pectoris	BA40	Phase 3	[2]
Alferminogene tadenovec	DMPH1RK	Angina pectoris	BA40	Phase 3	[3]
Generx	DM1WMOK	Angina pectoris	BA40	Phase 3	[4]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Interstitial cystitis	GA10	Bladder tissue	1.74E-01	0.04	0.45

References

• [1] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [2] Angiogenic gene therapy with adenovirus 5 fibroblast growth factor-4 (Ad5FGF-4): a new option for the treatment of coronary artery disease. Am J Cardiol. 2003 Nov 7;92(9B):24N-31N.
• [3] Alferminogene tadenovec, an angiogenic FGF4 gene therapy for coronary artery disease. IDrugs. 2008 Apr;11(4):283-93.
• [4] Effects of Ad5FGF-4 in patients with angina: an analysis of pooled data from the AGENT-3 and AGENT-4 trials. J Am Coll Cardiol. 2007 Sep 11;50(11):1038-46.