Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTFOUV4)

DTT Name	BCL-2 messenger RNA (BCL2 mRNA)
Synonyms	Bcl-2 (mRNA); Apoptosis regulator Bcl-2 (mRNA)
Gene Name	BCL2
DTT Type	Clinical trial target	[1]
BioChemical Class	mRNA target
UniProt ID	BCL2_HUMAN
TTD ID	T47387
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Function	Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release. Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
KEGG Pathway	NF-kappa B signaling pathway (hsa04064 ) HIF-1 signaling pathway (hsa04066 ) Sphingolipid signaling pathway (hsa04071 ) Protein processing in endoplasmic reticulum (hsa04141 ) PI3K-Akt signaling pathway (hsa04151 ) Apoptosis (hsa04210 ) Adrenergic signaling in cardiomyocytes (hsa04261 ) Focal adhesion (hsa04510 ) Neurotrophin signaling pathway (hsa04722 ) Cholinergic synapse (hsa04725 ) Amyotrophic lateral sclerosis (ALS) (hsa05014 ) Toxoplasmosis (hsa05145 ) Tuberculosis (hsa05152 ) Hepatitis B (hsa05161 ) Epstein-Barr virus infection (hsa05169 ) Pathways in cancer (hsa05200 ) MicroRNAs in cancer (hsa05206 ) Colorectal cancer (hsa05210 ) Prostate cancer (hsa05215 ) Small cell lung cancer (hsa05222 )
Reactome Pathway	BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members (R-HSA-111453 ) The NLRP1 inflammasome (R-HSA-844455 ) Activation of BAD and translocation to mitochondria (R-HSA-111447 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PNT-2258	DMUVON0	Diffuse large B-cell lymphoma	2A81	Phase 2	[1]
Beclanorsen	DMXVRI0	leukaemia	2A60-2B33	Phase 1/2	[2]
BP1002	DMI826O	Haematopoietic/lymphoid cancer	2B33.5	Phase 1	[3]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BP-100-1.02	DMGEYFB	Lymphoma	2A80-2A86	Investigative	[4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2C82	Bone marrow	8.27E-03	0.06	0.13
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of ProNAi.
2	Combination of novel imidazopyridazine mps-1 kinase inhibitors and bcl-2 family protein inhibitors. ACS Med Chem Lett. 2014 Jul 30;6(1):7-8.
3	Clinical pipeline report, company report or official report of Bio-Path Holdings.
4	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2844).