Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTG6LA7)

• DTT Name: Activation-inducible TNFR family receptor (TNFRSF18)
• Synonyms: UNQ319/PRO364; Tumor necrosis factor receptor superfamily member 18; Glucocorticoid-induced TNFR-related protein; GITR; CD357; AITR
• Gene Name: TNFRSF18
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine receptor
• UniProt ID: TNR18_HUMAN
• TTD ID: T15344
• Sequence:
  MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
  YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF
  SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL
  TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW
  V
• Function: Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway. Receptor for TNFSF18.
• KEGG Pathway: Cytokine-cytokine receptor interaction (hsa04060)
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DTT

8 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
INCAGN01876	DMNUXKA	Solid tumour/cancer	2A00-2F9Z	Phase 2	[2]
INCAGN1876	DM8XN4A	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[3]
TRX-518	DMQS5DY	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[1]
AMG 228	DMLQJ5P	Solid tumour/cancer	2A00-2F9Z	Phase 1	[4]
ASP1951	DMX4PWV	Solid tumour/cancer	2A00-2F9Z	Phase 1	[5]
MK-4166	DML5V76	Solid tumour/cancer	2A00-2F9Z	Phase 1	[6]
REGN6569	DM0ZMNI	Squamous head and neck cell carcinom	2D60.0	Phase 1	[7]
TRX518	DM9IDUH	Solid tumour/cancer	2A00-2F9Z	Phase 1	[8]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Melanoma	2C82	Skin	2.39E-03	-0.54	-0.7

References

• [1] Immuno-oncology moves beyond PD-1. Nat Biotechnol. 2015 Jul;33(7):673-5.
• [2] Clinical pipeline report, company report or official report of Agenus.
• [3] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [4] Dose escalation results from a first-in-human, phase 1 study of glucocorticoid-induced TNF receptor-related protein agonist AMG 228 in patients with advanced solid tumors. J Immunother Cancer. 2018 Sep 25;6(1):93.
• [5] ClinicalTrials.gov (NCT03799003) A Study of ASP1951 in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health.
• [6] Immuno-oncology moves beyond PD-1. Nat Biotechnol. 2015 Jul;33(7):673-5.
• [7] Clinical pipeline report, company report or official report of Regeneron Pharmaceuticals.
• [8] Clinical pipeline report, company report or official report of Leap Therapeutics.