Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTG6VD5)

• DTT Name: Monocarboxylate transporter 4 (SLC16A3)
• Synonyms: Solute carrier family 16 member 3; MCT4; MCT 4
• Gene Name: SLC16A3
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Major facilitator
• UniProt ID: MOT4_HUMAN
• TTD ID: T31788
• Sequence:
  MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDT
  AWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGV
  ITGLGLALNFQPSLIMLNRYFSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGF
  LILGGLLLNCCVCAALMRPLVVTAQPGSGPPRPSRRLLDLSVFRDRGFVLYAVAASVMVL
  GLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPAAGFVAGLGKVRPYSVYLFSF
  SMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTHKFSSAIGLVL
  LMEAVAVLVGPPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE
  VAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV
• Function: Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Proton-linked monocarboxylate transporter.
• KEGG Pathway: Central carbon metabolism in cancer (hsa05230)
• Reactome Pathway:
  Proton-coupled monocarboxylate transport (R-HSA-433692)
  Pyruvate metabolism (R-HSA-70268)
  Basigin interactions (R-HSA-210991)

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Monocarboxylate transporter 4 (SLC16A3) DTP Info
• Gene Name: SLC16A3

1 Investigative Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Milchsaure	DM462BT	Pruritus	EC90	Investigative	[2]

References

• [1] High expression of monocarboxylate transporter 4 predicts poor prognosis in patients with lung adenocarcinoma. Oncol Lett. 2017 Nov;14(5):5727-5734.
• [2] The low-affinity monocarboxylate transporter MCT4 is adapted to the export of lactate in highly glycolytic cells. Biochem J. 2000 Aug 15;350 Pt 1:219-27.