Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTGW72V)

• DTT Name: Interleukin-12 beta (IL12B)
• Synonyms: NKSF2; NK cell stimulatory factor chain 2; Interleukin12 subunit beta; Interleukin-12 subunit beta; IL12 subunit p40; IL-12B; IL-12 subunit p40; Cytotoxic lymphocyte maturation factor 40 kDa subunit; CLMF p40
• Gene Name: IL12B
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL12B_HUMAN
• TTD ID: T95385
• Sequence:
  MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
  TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
  KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
  RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
  LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
  RKNASISVRAQDRYYSSSWSEWASVPCS
• Function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Toll-like receptor signaling pathway (hsa04620)
  RIG-I-like receptor signaling pathway (hsa04622)
  Jak-STAT signaling pathway (hsa04630)
  Type I diabetes mellitus (hsa04940)
  Pertussis (hsa05133)
  Legionellosis (hsa05134)
  Leishmaniasis (hsa05140)
  Chagas disease (American trypanosomiasis) (hsa05142)
  African trypanosomiasis (hsa05143)
  Malaria (hsa05144)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Tuberculosis (hsa05152)
  Measles (hsa05162)
  Influenza A (hsa05164)
  Herpes simplex infection (hsa05168)
  Inflammatory bowel disease (IBD) (hsa05321)
  Allograft rejection (hsa05330)
• Reactome Pathway:
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Interleukin-12 signaling (R-HSA-9020591)
  Interleukin-23 signaling (R-HSA-9020933)
  Interleukin-10 signaling (R-HSA-6783783)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Isoproterenol	DMK7MEY	Atrioventricular block		Approved	[1]

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABT-874	DMYHSO2	Plaque psoriasis	EA90.0	Phase 3	[2]
EGEN-001	DM6L5TR	Fallopian tube cancer	2C74	Phase 2	[3]
SFV IL-12 gene therapy	DMVIWNK	Breast cancer	2C60-2C65	Phase 2	[4]
Ad-IL-12 DNA therapeutic	DMB19IO	Melanoma	2C30	Phase 1/2	[5]
NHS-IL 12	DMU6CQ7	Solid tumour/cancer	2A00-2F9Z	Phase 1	[6]
PF-07261271	DM0K4WQ	Inflammatory bowel disease	DD72	Phase 1	[7]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rheumatoid arthritis	FA20	Synovial tissue	9.01E-01	1.32E-02	0.07
Melanoma	2C82	Skin	1.08E-01	0.13	0.17

References

• [1] A phase 1 study of AS1409, a novel antibody-cytokine fusion protein, in patients with malignant melanoma or renal cell carcinoma. Clin Cancer Res. 2011 Apr 1;17(7):1998-2005.
• [2] Briakinumab for the treatment of plaque psoriasis.BioDrugs.2012 Feb 1;26(1):9-20.
• [3] National Cancer Institute Drug Dictionary (drug id 454593).
• [4] Clinical pipeline report, company report or official report of Trademarkia.
• [5] National Cancer Institute Drug Dictionary (drug id 710508).
• [6] The immunocytokine NHS-IL12 as a potential cancer therapeutic. Oncotarget. 2014 Apr 15;5(7):1869-84.
• [7] Clinical pipeline report, company report or official report of Pfizer