Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHPFTS)

• DTT Name: Plasmodium Beta-hydroxyacyl-ACP dehydratase (Malaria FabZ)
• Synonyms: fabZ; Fatty acid synthesis protein; Beta-hydroxyacyl-ACP dehydratase; 17 kDa actomyosin component; (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; (3R)-hydroxymyristoyl-ACP dehydrase
• Gene Name: Malaria FabZ
• DTT Type: Clinical trial target; [1]
• Related Disease: Hepatic fibrosis/cirrhosis [ICD-11: DB93]
• UniProt ID: Q965D7_PLAFA
• TTD ID: T01943
• Sequence:
  MRFLIIHIAVIVLPFVLMIDVKRENSFFLRHSPKRLYKKADYNNMYDKIIKKQQNRIYDV
  SSQINQDNINGQNISFNLTFPNYDTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGL
  KQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWK
  KPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALSK
• Function: Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs.
• KEGG Pathway:
  Fatty acid biosynthesis (pfa00061)
  Biotin metabolism (pfa00780)
  Metabolic pathways (pfa01100)
  Fatty acid metabolism (pfa01212)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Epigallocatechin gallate	DMCGWBJ	Hepatic fibrosis	DB93.0	Phase 3	[2]

6 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(-)-CATECHINGALLATE	DMZOGSK	Discovery agent	N.A.	Investigative	[2]
2-Hexadecynoic acid	DMTFIPZ	Discovery agent	N.A.	Investigative	[3]
3,7,3',4'-TETRAHYDROXYFLAVONE	DMES906	Discovery agent	N.A.	Investigative	[2]
biochanin A	DM0HPWY	Discovery agent	N.A.	Investigative	[2]
GALLOCATECHIN GALLATE	DMX2084	Discovery agent	N.A.	Investigative	[2]
Morin	DM2OGZ5	Discovery agent	N.A.	Investigative	[2]

References

• [1] Antiplasmodial drug targets: a patent review (2000 - 2013).Expert Opin Ther Pat. 2016;26(1):107-30.
• [2] Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. J Med Chem. 2006 Jun 1;49(11):3345-53.
• [3] 2-Hexadecynoic acid inhibits plasmodial FAS-II enzymes and arrests erythrocytic and liver stage Plasmodium infections. Bioorg Med Chem. 2010 Nov 1;18(21):7475-85.