Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTJDUNO)

• DTT Name: T-cell surface antigen CD2 (CD2)
• Synonyms: T-cell surface antigen T11/Leu-5; SRBC; Rosette receptor; LFA-3 receptor; LFA-2; Erythrocyte receptor
• Gene Name: CD2
• DTT Type: Clinical trial target; [1]
• UniProt ID: CD2_HUMAN
• TTD ID: T02532
• Sequence:
  MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
  KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK
  IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
  SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
  RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
  GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
• Function: CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function. CD2 interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types.
• KEGG Pathway:
  Cell adhesion molecules (CAMs) (hsa04514)
  Hematopoietic cell lineage (hsa04640)
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Siplizumab	DM75RFJ	Lymphoma	2A80-2A86	Phase 2	[1]

6 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alpha-D-Mannose	DMF5DLW	Discovery agent	N.A.	Investigative	[2]
Cyclo(1,10)EIYDPGDDIK	DMFUG05	Discovery agent	N.A.	Investigative	[3]
Cyclo(1,10)H-EIYDPGDDIK-OH	DM5CBQ9	Discovery agent	N.A.	Investigative	[3]
Cyclo(1,11)H-ESIYDPGDDIK-OH	DM4A1TF	Discovery agent	N.A.	Investigative	[3]
Cyclo(1,12)PenIYDTKGKNVLC-OH	DMVDS8B	Discovery agent	N.A.	Investigative	[4]
Pen(Acm)AQFRKEKETFC(Acm)-OH	DM81AWU	Discovery agent	N.A.	Investigative	[4]

References

• [1] Emerging drugs for moderate-to-severe psoriasis. Expert Opin Emerg Drugs. 2005 Feb;10(1):35-52.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [3] Design of beta-hairpin peptides for modulation of cell adhesion by beta-turn constraint. J Med Chem. 2009 Feb 12;52(3):726-36.
• [4] Structure-activity studies of peptides from the "hot-spot" region of human CD2 protein: development of peptides for immunomodulation. J Med Chem. 2005 Oct 6;48(20):6236-49.