Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTJE54U)

• DTT Name: Solute carrier family 38 member 4 (SLC38A4)
• Synonyms: System N amino acid transporter 3; System A amino acid transporter 3; Sodium-coupled neutral amino acid transporter 4; SNAT4; Na(+)-coupled neutral amino acid transporter 4; NAT3; Amino acid transporter A3; ATA3
• Gene Name: SLC38A4
• DTT Type: Literature-reported target; [1]
• UniProt ID: S38A4_HUMAN
• TTD ID: T13252
• Sequence:
  MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGK
  KKLADYADEHHPGTTSFGMSSFNLSNAIMGSGILGLSYAMANTGIILFIIMLLAVAILSL
  YSVHLLLKTAKEGGSLIYEKLGEKAFGWPGKIGAFVSITMQNIGAMSSYLFIIKYELPEV
  IRAFMGLEENTGEWYLNGNYLIIFVSVGIILPLSLLKNLGYLGYTSGFSLTCMVFFVSVV
  IYKKFQIPCPLPVLDHSVGNLSFNNTLPMHVVMLPNNSESSDVNFMMDYTHRNPAGLDEN
  QAKGSLHDSGVEYEAHSDDKCEPKYFVFNSRTAYAIPILVFAFVCHPEVLPIYSELKDRS
  RRKMQTVSNISITGMLVMYLLAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVL
  VAVTLTVPIVLFPIRTSVITLLFPKRPFSWIRHFLIAAVLIALNNVLVILVPTIKYIFGF
  IGASSATMLIFILPAVFYLKLVKKETFRSPQKVGALIFLVVGIFFMIGSMALIIIDWIYD
  PPNSKHH
• Function: Sodium-dependent amino acid transporter. Mediates electrogenic symport of neutral amino acids and sodium ions. Has a broad specificity, with a preference for Ala, followed by His, Cys, Asn, Ser, Gly, Val, Thr, Gln and Met. May mediate sodium-independent transport of cationic amino acids, such as Arg and Lys. Amino acid uptake is pH-dependent, with low transport activities at pH 6.5, intermediate at pH 7.0 and highest between pH 7.5 and 8.5.
• Reactome Pathway: Amino acid transport across the plasma membrane (R-HSA-352230)

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Sodium-coupled neutral amino acid transporter 4 (SLC38A4) DTP Info
• Gene Name: SLC38A4

2 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
L-Alanine	DMZDN4W	Dietary shortage	5B5K	Approved	[2]
L-glutamine	DM69G8X	Short bowel syndrome	KB89.1	Approved	[2]

References

• [1] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1171).
• [2] Identification of SLC38A7 (SNAT7) protein as a glutamine transporter expressed in neurons. J Biol Chem. 2011 Jun 10;286(23):20500-11.