General Information of Drug Therapeutic Target (DTT) (ID: TTK8R02)

DTT Name Vasopressin V2 receptor (V2R)
Synonyms Renal-type arginine vasopressin receptor; DIR3; DIR; Antidiuretic hormone receptor; AVPR V2; ADHR
Gene Name AVPR2
DTT Type
Successful target
[1]
BioChemical Class
GPCR rhodopsin
UniProt ID
V2R_HUMAN
TTD ID
T66237
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
Function The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption. Receptor for arginine vasopressin.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Vasopressin-regulated water reabsorption (hsa04962 )
Reactome Pathway
G alpha (s) signalling events (R-HSA-418555 )
Vasopressin regulates renal water homeostasis via Aquaporins (R-HSA-432040 )
Vasopressin-like receptors (R-HSA-388479 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
7 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Conivaptan DM1V329 Euvolemic hyponatremia 5C72 Approved [2]
Desmopressin DMS3GVE Diabetic complication 5A2Y Approved [3]
Mozavaptan DMZ905C Hyponatraemia 5C72 Approved [4]
Oxytocin DMDL27I Autism spectrum disorder 6A02 Approved [5]
Tolvaptan DMIWFRL Autosomal dominant polycystic kidney disease GB81 Approved [6]
Vasopressin DMQ2FPC Diabetes insipidus 5A61.5 Approved [1]
ATOSIBAN DMB7WYM N. A. N. A. Phase 4 [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Approved Drug(s)
6 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Lixivaptan DMDN4ZP Hyponatraemia 5C72 Phase 3 [8]
Satavaptan DME5PN3 Acute and chronic heart failure BD1Z Phase 3 [9]
ASP-7035 DMTF24A Nocturia MF55 Phase 2 [10]
SPD-556 DM9OPK3 Heart failure BD10-BD13 Phase 2 [5]
SSR149415 DMCMD93 Anxiety disorder 6B00-6B0Z Phase 2 [11]
VA-106483 DM1ODP6 Nocturia MF55 Phase 2 [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Clinical Trial Drug(s)
4 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
OPC-51803 DMDCOSP Urinary incontinence MF50.2 Discontinued in Phase 1 [13]
OX 19 DM5UYI7 Urinary incontinence MF50.2 Discontinued in Phase 1 [14]
VNA-932 DMKRG0I Urinary incontinence MF50.2 Discontinued in Phase 1 [15]
JTV-605 DM89TXB Dysmenorrhea GA34.3 Terminated [4]
------------------------------------------------------------------------------------
34 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ARGENINE VASOPRESSIN DM8KN0Q Discovery agent N.A. Investigative [16]
CL-385004 DMLQZGJ Discovery agent N.A. Investigative [4]
d(CH2)5[D-Ile2,Ile4]AVP DMAX7LW Discovery agent N.A. Investigative [17]
D(CH2)5[Tyr(Me)2,Thr4,Orn8,Tyr9-NH2]VT DM1BMT7 Discovery agent N.A. Investigative [18]
d(CH2)5[Tyr(Me)2]AVP DMHTSAX Discovery agent N.A. Investigative [17]
DVDAVP DM53079 Discovery agent N.A. Investigative [16]
D[Arg4,Dab8]VP DMCU8HK Discovery agent N.A. Investigative [16]
D[Arg4,Lys8]VP DM69OVM Discovery agent N.A. Investigative [16]
D[Arg4,Orn8]VP DM8D4QT Discovery agent N.A. Investigative [16]
D[Arg4]AVP DM76Q2B Discovery agent N.A. Investigative [16]
D[Cha4,Dab8]VP DMCLUXI Discovery agent N.A. Investigative [16]
D[Cha4,Dap8]VP DMAPZKB Discovery agent N.A. Investigative [16]
D[Cha4,Lys8]VP DM0GO7U Discovery agent N.A. Investigative [16]
D[Cha4,Orn8]VP DMZWTJK Discovery agent N.A. Investigative [16]
D[Cha4]AVP DM8FCX5 Discovery agent N.A. Investigative [16]
D[D-3-Pal2]AVP DMD4V6U Discovery agent N.A. Investigative [16]
D[Leu4,Dab8]VP DMNSXG9 Discovery agent N.A. Investigative [16]
D[Leu4,Dap8]VP DME3HK8 Discovery agent N.A. Investigative [16]
D[Leu4,Lys8]VP DMDBU7Q Discovery agent N.A. Investigative [16]
D[Leu4,Orn8]VP DMJCW8Y Discovery agent N.A. Investigative [16]
D[Leu4]AVP DMREZT7 Discovery agent N.A. Investigative [16]
D[Orn4,Lys8]VP DMNQTBU Discovery agent N.A. Investigative [16]
D[Orn4,Orn8]VP DMONV0M Discovery agent N.A. Investigative [16]
D[Orn4]AVP DMJNT95 Discovery agent N.A. Investigative [16]
d[Pen1,Tyr(Me)2]AVP DMT8KI6 Discovery agent N.A. Investigative [17]
D[Val4]AVP DM3GM8E Discovery agent N.A. Investigative [16]
FR161282 DMZSFEP Discovery agent N.A. Investigative [4]
L-372662 DMQV974 Discovery agent N.A. Investigative [19]
VP-343 DMT03VB Discovery agent N.A. Investigative [4]
YM 218 DMPYM3J Discovery agent N.A. Investigative [20]
YM 471 DM5BFL4 Discovery agent N.A. Investigative [21]
YM-35278 DMXRZ6N Discovery agent N.A. Investigative [22]
[Phe3]OT DMK18CS Discovery agent N.A. Investigative [23]
[Val4]AVP DMW82ZT Discovery agent N.A. Investigative [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 34 Investigative Drug(s)

References

1 Vasopressin receptors: structure/function relationships and signal transduction in target cells. J Soc Biol. 2005;199(4):351-9.
2 Acute hemodynamic effects of conivaptan, a dual V(1A) and V(2) vasopressin receptor antagonist, in patients with advanced heart failure. Circulation. 2001 Nov 13;104(20):2417-23.
3 Design of potent and selective agonists for the human vasopressin V1b receptor based on modifications of [deamino-cys1]arginine vasopressin at position 4. J Med Chem. 2004 Apr 22;47(9):2375-88.
4 Nonpeptide vasopressin receptor antagonists: development of selective and orally active V1a, V2 and V1b receptor ligands. Prog Brain Res. 2002;139:197-210.
5 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 368).
6 Antibody-mediated disruption of the interaction between PCSK9 and the low-density lipoprotein receptor. Biochem J. 2009 May 1;419(3):577-84.
7 The discovery of GSK221149A: a potent and selective oxytocin antagonist. Bioorg Med Chem Lett. 2008 Jan 1;18(1):90-4.
8 Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95.
9 Post-translational import of protein into the endoplasmic reticulum of a trypanosome: an in vitro system for discovery of anti-trypanosomal chemical entities. Biochem J. 2009 Apr 15;419(2):507-17.
10 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030285)
11 Tetrahydroquinoline sulfonamides as vasopressin 1b receptor antagonists. Bioorg Med Chem Lett. 2009 Nov 1;19(21):6018-22.
12 New benzylureas as a novel series of potent, nonpeptidic vasopressin V2 receptor agonists. J Med Chem. 2008 Dec 25;51(24):8124-34.
13 Effects of OPC-51803, a novel, nonpeptide vasopressin V2-receptor agonist, on micturition frequency in Brattleboro and aged rats. J Pharmacol Sci. 2003 Dec;93(4):484-8.
14 Investigation of mechanism of desmopressin binding in vasopressin V2 receptor versus vasopressin V1a and oxytocin receptors: molecular dynamics simulation of the agonist-bound state in the membrane-aqueous system. Biopolymers. 2006 Apr 5;81(5):321-38.
15 Biased Agonist Pharmacochaperones of the AVP V2 Receptor May Treat Congenital Nephrogenic Diabetes Insipidus. J Am Soc Nephrol. 2009 October; 20(10): 2190-2203.
16 Design and synthesis of the first selective agonists for the rat vasopressin V(1b) receptor: based on modifications of deamino-[Cys1]arginine vasop... J Med Chem. 2007 Feb 22;50(4):835-47.
17 Binding properties of a selective tritiated vasopressin V2 receptor antagonist, [H]-SR 121463. Kidney Int. 2000 Oct;58(4):1613-22.
18 Synthesis and characterization of fluorescent antagonists and agonists for human oxytocin and vasopressin V(1)(a) receptors. J Med Chem. 2002 Jun 6;45(12):2579-88.
19 Oral oxytocin antagonists. J Med Chem. 2010 Sep 23;53(18):6525-38.
20 Effects of YM218, a nonpeptide vasopressin V1A receptor-selective antagonist, on human vasopressin and oxytocin receptors. Pharmacol Res. 2005 Mar;51(3):275-81.
21 Effects of YM471, a nonpeptide AVP V(1A) and V(2) receptor antagonist, on human AVP receptor subtypes expressed in CHO cells and oxytocin receptors in human uterine smooth muscle cells. Br J Pharmacol. 2001 Jul;133(5):746-54.
22 Preparation of (4,4-difluoro-1,2,3,4-tetrahydro-5H-1-benzazepin-5-ylidene)acetamide derivatives as novel arginine vasopressin V(2) receptor agonists. Bioorg Med Chem. 2008 Nov 1;16(21):9524-35.
23 Tyr115 is the key residue for determining agonist selectivity in the V1a vasopressin receptor. EMBO J. 1995 May 15;14(10):2176-82.
24 [1-deamino-4-cyclohexylalanine] arginine vasopressin: a potent and specific agonist for vasopressin V1b receptors. Endocrinology. 2002 Dec;143(12):4655-64.