Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTNQ5ZP)

DTT Name	Myc messenger RNA (MYC mRNA)
Synonyms	bHLHe39 (mRNA); Transcription factor p64 (mRNA); Proto-oncogene c-Myc (mRNA); Myc proto-oncogene protein (mRNA); Class E basic helix-loop-helix protein 39 (mRNA); C-myc oncogene (mRNA); C-myc (mRNA)
Gene Name	MYC
DTT Type	Clinical trial target	[1]
BioChemical Class	mRNA target
UniProt ID	MYC_HUMAN
TTD ID	T85651
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL RKRREQLKHKLEQLRNSCA
Function	Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'.
KEGG Pathway	MAPK signaling pathway (hsa04010 ) ErbB signaling pathway (hsa04012 ) Cell cycle (hsa04110 ) PI3K-Akt signaling pathway (hsa04151 ) Wnt signaling pathway (hsa04310 ) TGF-beta signaling pathway (hsa04350 ) Hippo signaling pathway (hsa04390 ) Signaling pathways regulating pluripotency of stem cells (hsa04550 ) Jak-STAT signaling pathway (hsa04630 ) Thyroid hormone signaling pathway (hsa04919 ) Hepatitis B (hsa05161 ) HTLV-I infection (hsa05166 ) Epstein-Barr virus infection (hsa05169 ) Pathways in cancer (hsa05200 ) Transcriptional misregulation in cancer (hsa05202 ) Proteoglycans in cancer (hsa05205 ) MicroRNAs in cancer (hsa05206 ) Colorectal cancer (hsa05210 ) Endometrial cancer (hsa05213 ) Thyroid cancer (hsa05216 ) Bladder cancer (hsa05219 ) Chronic myeloid leukemia (hsa05220 ) Acute myeloid leukemia (hsa05221 ) Small cell lung cancer (hsa05222 ) Central carbon metabolism in cancer (hsa05230 )
Reactome Pathway	SMAD2/SMAD3 (R-HSA-2173796 ) Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606 ) Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862 ) Binding of TCF/LEF (R-HSA-4411364 ) MAPK6/MAPK4 signaling (R-HSA-5687128 ) Cyclin E associated events during G1/S transition (R-HSA-69202 ) Cyclin A (R-HSA-69656 ) NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947 )
BioCyc Pathway	MetaCyc:ENSG00000136997-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AVI-5126	DMUOYQR	Coronary artery disease	BA80	Phase 2	[1]
Resten-NG	DMM4EJI	Coronary artery disease	BA80	Phase 2	[2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Coronary artery disease	BA80-BA8Z	Peripheral blood	6.09E-01	0.25	0.37
------------------------------------------------------------------------------------

References

1	Efficacy of a phosphorodiamidate morpholino oligomer antisense compound in the inhibition of corneal transplant rejection in a rat cornea transplant model. J Ocul Pharmacol Ther. 2012 Apr;28(2):194-201.
2	Local delivery of c-myc neutrally charged antisense oligonucleotides with transport catheter inhibits myointimal hyperplasia and positively affects vascular remodeling in the rabbit balloon injury model. Catheter Cardiovasc Interv. 2001 Oct;54(2):247-56.